PDB entry 1oqf

View 1oqf on RCSB PDB site
Description: Crystal structure of the 2-methylisocitrate lyase
Class: lyase
Keywords: structural genomics, alpha-beta barrel, swapped helix across a dimer, Structure 2 Function Project, S2F, LYASE
Deposited on 2003-03-08, released 2004-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.191
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-methylisocitrate lyase
    Species: Escherichia coli [TaxId:562]
    Gene: PRPB OR B0331
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1oqfa_
  • Chain 'B':
    Compound: 2-methylisocitrate lyase
    Species: Escherichia coli [TaxId:562]
    Gene: PRPB OR B0331
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1oqfb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oqfA (A:)
    slhspgkafraaltkenplqivgtinanhallaqragyqaiylsgggvaagslglpdlgi
    stlddvltdirritdvcslpllvdadigfgssafnvartvksmikagaaglhiedqvgak
    rcghrpnkaivskeemvdriraavdaktdpdfvimartdalavegldaaieraqayveag
    aemlfpeaitelamyrqfadavqvpilanitefgatplfttdelrsahvamalyplsafr
    amnraaehvynvlrqegtqksvidtmqtrnelyesinyyqyeekldnlfarsqvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oqfA (A:)
    slhspgkafraaltkenplqivgtinanhallaqragyqaiylsgggvaagslglpdlgi
    stlddvltdirritdvcslpllvdadigfgssafnvartvksmikagaaglhiedqvgak
    rcghrpnkaivskeemvdriraavdaktdpdfvimartdalavegldaaieraqayveag
    aemlfpeaitelamyrqfadavqvpilanitefgatplfttdelrsahvamalyplsafr
    amnraaehvynvlrqegtqksvidtmqtrnelyesinyyqyeekldnlfa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oqfB (B:)
    slhspgkafraaltkenplqivgtinanhallaqragyqaiylsgggvaagslglpdlgi
    stlddvltdirritdvcslpllvdadigfgssafnvartvksmikagaaglhiedqvgak
    rcghrpnkaivskeemvdriraavdaktdpdfvimartdalavegldaaieraqayveag
    aemlfpeaitelamyrqfadavqvpilanitefgatplfttdelrsahvamalyplsafr
    amnraaehvynvlrqegtqksvidtmqtrnelyesinyyqyeekldnlfarsqvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oqfB (B:)
    slhspgkafraaltkenplqivgtinanhallaqragyqaiylsgggvaagslglpdlgi
    stlddvltdirritdvcslpllvdadigfgssafnvartvksmikagaaglhiedqvgak
    rcghrpnkaivskeemvdriraavdaktdpdfvimartdalavegldaaieraqayveag
    aemlfpeaitelamyrqfadavqvpilanitefgatplfttdelrsahvamalyplsafr
    amnraaehvynvlrqegtqksvidtmqtrnelyesinyyqyeekldnlfa