PDB entry 1oq7

View 1oq7 on RCSB PDB site
Description: The crystal structure of the iron free (Apo-)form of Stearoyl Acyl Carrier Protein Desaturase from Ricinus Communis (Castor Bean).
Class: oxidoreductase
Keywords: di-iron enzyme, four-helix bundle, fatty acid biosynthesis, electron transfer, OXIDOREDUCTASE
Deposited on 2003-03-07, released 2003-05-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.229
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acyl-[acyl-carrier protein] desaturase
    Species: Ricinus communis [TaxId:3988]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1oq7a_
  • Chain 'B':
    Compound: Acyl-[acyl-carrier protein] desaturase
    Species: Ricinus communis [TaxId:3988]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1oq7b_
  • Chain 'C':
    Compound: Acyl-[acyl-carrier protein] desaturase
    Species: Ricinus communis [TaxId:3988]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1oq7c_
  • Chain 'D':
    Compound: Acyl-[acyl-carrier protein] desaturase
    Species: Ricinus communis [TaxId:3988]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1oq7d_
  • Chain 'E':
    Compound: Acyl-[acyl-carrier protein] desaturase
    Species: Ricinus communis [TaxId:3988]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1oq7e_
  • Chain 'F':
    Compound: Acyl-[acyl-carrier protein] desaturase
    Species: Ricinus communis [TaxId:3988]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1oq7f_
  • Heterogens: SR

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oq7A (A:)
    astlksgskevenlkkpfmpprevhvqvthsmppqkieifksldnwaeenilvhlkpvek
    cwqpqdflpdpasdgfdeqvrelrerakeipddyfvvlvgdmiteealptyqtmlntldg
    vrdetgasptswaiwtrawtaeenrhgdllnkylylsgrvdmrqiektiqyligsgmdpr
    tenspylgfiytsfqeratfishgntarqakehgdiklaqicgtiaadekrhetaytkiv
    eklfeidpdgtvlafadmmrkkismpahlmydgrddnlfdhfsavaqrlgvytakdyadi
    leflvgrwkvdkltglsaegqkaqdyvcrlpprirrleeraqgrakeaptmpfswifdrq
    vkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oq7A (A:)
    fmpprevhvqvthsmppqkieifksldnwaeenilvhlkpvekcwqpqdflpdpasdgfd
    eqvrelrerakeipddyfvvlvgdmiteealptyqtmlntldgvrdetgasptswaiwtr
    awtaeenrhgdllnkylylsgrvdmrqiektiqyligsgmdprtenspylgfiytsfqer
    atfishgntarqakehgdiklaqicgtiaadekrhetaytkiveklfeidpdgtvlafad
    mmrkkismpahlmydgrddnlfdhfsavaqrlgvytakdyadileflvgrwkvdkltgls
    aegqkaqdyvcrlpprirrleeraqgrakeaptmpfswifdrqvkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oq7B (B:)
    astlksgskevenlkkpfmpprevhvqvthsmppqkieifksldnwaeenilvhlkpvek
    cwqpqdflpdpasdgfdeqvrelrerakeipddyfvvlvgdmiteealptyqtmlntldg
    vrdetgasptswaiwtrawtaeenrhgdllnkylylsgrvdmrqiektiqyligsgmdpr
    tenspylgfiytsfqeratfishgntarqakehgdiklaqicgtiaadekrhetaytkiv
    eklfeidpdgtvlafadmmrkkismpahlmydgrddnlfdhfsavaqrlgvytakdyadi
    leflvgrwkvdkltglsaegqkaqdyvcrlpprirrleeraqgrakeaptmpfswifdrq
    vkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oq7B (B:)
    fmpprevhvqvthsmppqkieifksldnwaeenilvhlkpvekcwqpqdflpdpasdgfd
    eqvrelrerakeipddyfvvlvgdmiteealptyqtmlntldgvrdetgasptswaiwtr
    awtaeenrhgdllnkylylsgrvdmrqiektiqyligsgmdprtenspylgfiytsfqer
    atfishgntarqakehgdiklaqicgtiaadekrhetaytkiveklfeidpdgtvlafad
    mmrkkismpahlmydgrddnlfdhfsavaqrlgvytakdyadileflvgrwkvdkltgls
    aegqkaqdyvcrlpprirrleeraqgrakeaptmpfswifdrqvkl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1oq7C (C:)
    astlksgskevenlkkpfmpprevhvqvthsmppqkieifksldnwaeenilvhlkpvek
    cwqpqdflpdpasdgfdeqvrelrerakeipddyfvvlvgdmiteealptyqtmlntldg
    vrdetgasptswaiwtrawtaeenrhgdllnkylylsgrvdmrqiektiqyligsgmdpr
    tenspylgfiytsfqeratfishgntarqakehgdiklaqicgtiaadekrhetaytkiv
    eklfeidpdgtvlafadmmrkkismpahlmydgrddnlfdhfsavaqrlgvytakdyadi
    leflvgrwkvdkltglsaegqkaqdyvcrlpprirrleeraqgrakeaptmpfswifdrq
    vkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oq7C (C:)
    fmpprevhvqvthsmppqkieifksldnwaeenilvhlkpvekcwqpqdflpdpasdgfd
    eqvrelrerakeipddyfvvlvgdmiteealptyqtmlntldgvrdetgasptswaiwtr
    awtaeenrhgdllnkylylsgrvdmrqiektiqyligsgmdprtenspylgfiytsfqer
    atfishgntarqakehgdiklaqicgtiaadekrhetaytkiveklfeidpdgtvlafad
    mmrkkismpahlmydgrddnlfdhfsavaqrlgvytakdyadileflvgrwkvdkltgls
    aegqkaqdyvcrlpprirrleeraqgrakeaptmpfswifdrqvkl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1oq7D (D:)
    astlksgskevenlkkpfmpprevhvqvthsmppqkieifksldnwaeenilvhlkpvek
    cwqpqdflpdpasdgfdeqvrelrerakeipddyfvvlvgdmiteealptyqtmlntldg
    vrdetgasptswaiwtrawtaeenrhgdllnkylylsgrvdmrqiektiqyligsgmdpr
    tenspylgfiytsfqeratfishgntarqakehgdiklaqicgtiaadekrhetaytkiv
    eklfeidpdgtvlafadmmrkkismpahlmydgrddnlfdhfsavaqrlgvytakdyadi
    leflvgrwkvdkltglsaegqkaqdyvcrlpprirrleeraqgrakeaptmpfswifdrq
    vkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oq7D (D:)
    fmpprevhvqvthsmppqkieifksldnwaeenilvhlkpvekcwqpqdflpdpasdgfd
    eqvrelrerakeipddyfvvlvgdmiteealptyqtmlntldgvrdetgasptswaiwtr
    awtaeenrhgdllnkylylsgrvdmrqiektiqyligsgmdprtenspylgfiytsfqer
    atfishgntarqakehgdiklaqicgtiaadekrhetaytkiveklfeidpdgtvlafad
    mmrkkismpahlmydgrddnlfdhfsavaqrlgvytakdyadileflvgrwkvdkltgls
    aegqkaqdyvcrlpprirrleeraqgrakeaptmpfswifdrqvkl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1oq7E (E:)
    astlksgskevenlkkpfmpprevhvqvthsmppqkieifksldnwaeenilvhlkpvek
    cwqpqdflpdpasdgfdeqvrelrerakeipddyfvvlvgdmiteealptyqtmlntldg
    vrdetgasptswaiwtrawtaeenrhgdllnkylylsgrvdmrqiektiqyligsgmdpr
    tenspylgfiytsfqeratfishgntarqakehgdiklaqicgtiaadekrhetaytkiv
    eklfeidpdgtvlafadmmrkkismpahlmydgrddnlfdhfsavaqrlgvytakdyadi
    leflvgrwkvdkltglsaegqkaqdyvcrlpprirrleeraqgrakeaptmpfswifdrq
    vkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oq7E (E:)
    fmpprevhvqvthsmppqkieifksldnwaeenilvhlkpvekcwqpqdflpdpasdgfd
    eqvrelrerakeipddyfvvlvgdmiteealptyqtmlntldgvrdetgasptswaiwtr
    awtaeenrhgdllnkylylsgrvdmrqiektiqyligsgmdprtenspylgfiytsfqer
    atfishgntarqakehgdiklaqicgtiaadekrhetaytkiveklfeidpdgtvlafad
    mmrkkismpahlmydgrddnlfdhfsavaqrlgvytakdyadileflvgrwkvdkltgls
    aegqkaqdyvcrlpprirrleeraqgrakeaptmpfswifdrqvkl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1oq7F (F:)
    astlksgskevenlkkpfmpprevhvqvthsmppqkieifksldnwaeenilvhlkpvek
    cwqpqdflpdpasdgfdeqvrelrerakeipddyfvvlvgdmiteealptyqtmlntldg
    vrdetgasptswaiwtrawtaeenrhgdllnkylylsgrvdmrqiektiqyligsgmdpr
    tenspylgfiytsfqeratfishgntarqakehgdiklaqicgtiaadekrhetaytkiv
    eklfeidpdgtvlafadmmrkkismpahlmydgrddnlfdhfsavaqrlgvytakdyadi
    leflvgrwkvdkltglsaegqkaqdyvcrlpprirrleeraqgrakeaptmpfswifdrq
    vkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oq7F (F:)
    fmpprevhvqvthsmppqkieifksldnwaeenilvhlkpvekcwqpqdflpdpasdgfd
    eqvrelrerakeipddyfvvlvgdmiteealptyqtmlntldgvrdetgasptswaiwtr
    awtaeenrhgdllnkylylsgrvdmrqiektiqyligsgmdprtenspylgfiytsfqer
    atfishgntarqakehgdiklaqicgtiaadekrhetaytkiveklfeidpdgtvlafad
    mmrkkismpahlmydgrddnlfdhfsavaqrlgvytakdyadileflvgrwkvdkltgls
    aegqkaqdyvcrlpprirrleeraqgrakeaptmpfswifdrqvkl