PDB entry 1oq1

View 1oq1 on RCSB PDB site
Description: Crystal Structure of Protein of Unknown Function with Galectin-like Fold from Bacillus subtilis
Deposited on 2003-03-06, released 2003-09-23
The last revision prior to the SCOP 1.71 freeze date was dated 2003-09-23, with a file datestamp of 2003-09-23.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.182
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1oq1a_
  • Chain 'B':
    Domains in SCOP 1.71: d1oq1b_
  • Chain 'C':
    Domains in SCOP 1.71: d1oq1c_
  • Chain 'D':
    Domains in SCOP 1.71: d1oq1d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oq1A (A:)
    snamykegaclyrnplrsksdvkdwrmegggqisfddhslhlshvqdeahfvfwcpetfp
    dgiivtwdfspieqpglcmlffaaagirgedlfdpslrkrtgtypeyhsgdinalhlsyf
    rrkyaeerafrtcnlrksrgfhlaamgadplpspddadspyrmklikdkgyvhfsinglp
    ilewmddgstygpvltkgkigfrqmapmkavyrdfavhqavrr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oq1B (B:)
    snamykegaclyrnplrsksdvkdwrmegggqisfddhslhlshvqdeahfvfwcpetfp
    dgiivtwdfspieqpglcmlffaaagirgedlfdpslrkrtgtypeyhsgdinalhlsyf
    rrkyaeerafrtcnlrksrgfhlaamgadplpspddadspyrmklikdkgyvhfsinglp
    ilewmddgstygpvltkgkigfrqmapmkavyrdfavhqavrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oq1B (B:)
    mykegaclyrnplrsksdvkdwrmegggqisfddhslhlshvqdeahfvfwcpetfpdgi
    ivtwdfspieqpglcmlffaaagirgedlfdpslrkrtgtypeyhsgdinalhlsyfrrk
    yaeerafrtcnlrksrgfhlaamgadplpspddadspyrmklikdkgyvhfsinglpile
    wmddgstygpvltkgkigfrqmapmkavyrdfavhqavrr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1oq1C (C:)
    snamykegaclyrnplrsksdvkdwrmegggqisfddhslhlshvqdeahfvfwcpetfp
    dgiivtwdfspieqpglcmlffaaagirgedlfdpslrkrtgtypeyhsgdinalhlsyf
    rrkyaeerafrtcnlrksrgfhlaamgadplpspddadspyrmklikdkgyvhfsinglp
    ilewmddgstygpvltkgkigfrqmapmkavyrdfavhqavrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oq1C (C:)
    amykegaclyrnplrsksdvkdwrmegggqisfddhslhlshvqdeahfvfwcpetfpdg
    iivtwdfspieqpglcmlffaaagirgedlfdpslrkrtgtypeyhsgdinalhlsyfrr
    kyaeerafrtcnlrksrgfhlaamgadplpspddadspyrmklikdkgyvhfsinglpil
    ewmddgstygpvltkgkigfrqmapmkavyrdfavhqavrr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oq1D (D:)
    snamykegaclyrnplrsksdvkdwrmegggqisfddhslhlshvqdeahfvfwcpetfp
    dgiivtwdfspieqpglcmlffaaagirgedlfdpslrkrtgtypeyhsgdinalhlsyf
    rrkyaeerafrtcnlrksrgfhlaamgadplpspddadspyrmklikdkgyvhfsinglp
    ilewmddgstygpvltkgkigfrqmapmkavyrdfavhqavrr