PDB entry 1oq1

View 1oq1 on RCSB PDB site
Description: Crystal Structure of Protein of Unknown Function with Galectin-like Fold from Bacillus subtilis
Class: structural genomics, unknown function
Keywords: Structural genomics, Singleton, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2003-03-06, released 2003-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.182
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein yesU
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O31524 (3-222)
      • cloning artifact (0-2)
      • modified residue (3)
      • modified residue (26)
      • modified residue (78)
      • modified residue (145)
      • modified residue (162)
      • modified residue (184)
      • modified residue (204)
      • modified residue (207)
    Domains in SCOPe 2.07: d1oq1a1, d1oq1a2
  • Chain 'B':
    Compound: Protein yesU
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O31524 (3-222)
      • modified residue (3)
      • modified residue (26)
      • modified residue (78)
      • modified residue (145)
      • modified residue (162)
      • modified residue (184)
      • modified residue (204)
      • modified residue (207)
    Domains in SCOPe 2.07: d1oq1b_
  • Chain 'C':
    Compound: Protein yesU
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O31524 (3-222)
      • cloning artifact (2)
      • modified residue (3)
      • modified residue (26)
      • modified residue (78)
      • modified residue (145)
      • modified residue (162)
      • modified residue (184)
      • modified residue (204)
      • modified residue (207)
    Domains in SCOPe 2.07: d1oq1c1, d1oq1c2
  • Chain 'D':
    Compound: Protein yesU
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O31524 (3-222)
      • cloning artifact (0-2)
      • modified residue (3)
      • modified residue (26)
      • modified residue (78)
      • modified residue (145)
      • modified residue (162)
      • modified residue (184)
      • modified residue (204)
      • modified residue (207)
    Domains in SCOPe 2.07: d1oq1d1, d1oq1d2
  • Heterogens: ACY, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oq1A (A:)
    snamykegaclyrnplrsksdvkdwrmegggqisfddhslhlshvqdeahfvfwcpetfp
    dgiivtwdfspieqpglcmlffaaagirgedlfdpslrkrtgtypeyhsgdinalhlsyf
    rrkyaeerafrtcnlrksrgfhlaamgadplpspddadspyrmklikdkgyvhfsinglp
    ilewmddgstygpvltkgkigfrqmapmkavyrdfavhqavrr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oq1B (B:)
    snamykegaclyrnplrsksdvkdwrmegggqisfddhslhlshvqdeahfvfwcpetfp
    dgiivtwdfspieqpglcmlffaaagirgedlfdpslrkrtgtypeyhsgdinalhlsyf
    rrkyaeerafrtcnlrksrgfhlaamgadplpspddadspyrmklikdkgyvhfsinglp
    ilewmddgstygpvltkgkigfrqmapmkavyrdfavhqavrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oq1B (B:)
    mykegaclyrnplrsksdvkdwrmegggqisfddhslhlshvqdeahfvfwcpetfpdgi
    ivtwdfspieqpglcmlffaaagirgedlfdpslrkrtgtypeyhsgdinalhlsyfrrk
    yaeerafrtcnlrksrgfhlaamgadplpspddadspyrmklikdkgyvhfsinglpile
    wmddgstygpvltkgkigfrqmapmkavyrdfavhqavrr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1oq1C (C:)
    snamykegaclyrnplrsksdvkdwrmegggqisfddhslhlshvqdeahfvfwcpetfp
    dgiivtwdfspieqpglcmlffaaagirgedlfdpslrkrtgtypeyhsgdinalhlsyf
    rrkyaeerafrtcnlrksrgfhlaamgadplpspddadspyrmklikdkgyvhfsinglp
    ilewmddgstygpvltkgkigfrqmapmkavyrdfavhqavrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oq1C (C:)
    amykegaclyrnplrsksdvkdwrmegggqisfddhslhlshvqdeahfvfwcpetfpdg
    iivtwdfspieqpglcmlffaaagirgedlfdpslrkrtgtypeyhsgdinalhlsyfrr
    kyaeerafrtcnlrksrgfhlaamgadplpspddadspyrmklikdkgyvhfsinglpil
    ewmddgstygpvltkgkigfrqmapmkavyrdfavhqavrr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oq1D (D:)
    snamykegaclyrnplrsksdvkdwrmegggqisfddhslhlshvqdeahfvfwcpetfp
    dgiivtwdfspieqpglcmlffaaagirgedlfdpslrkrtgtypeyhsgdinalhlsyf
    rrkyaeerafrtcnlrksrgfhlaamgadplpspddadspyrmklikdkgyvhfsinglp
    ilewmddgstygpvltkgkigfrqmapmkavyrdfavhqavrr