PDB entry 1opx

View 1opx on RCSB PDB site
Description: Crystal structure of the traffic ATPase (HP0525) of the Helicobacter pylori type IV secretion system bound by sulfate
Class: hydrolase
Keywords: VirB11 ATPase, bacterial type IV secretion, sulfate, HP0525, Helicobacter pylori, HYDROLASE
Deposited on 2003-03-06, released 2003-05-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.25
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: virB11 homolog
    Species: HELICOBACTER PYLORI [TaxId:85962]
    Gene: hp0525
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7BK04
      • modified residue (41)
      • modified residue (81)
      • modified residue (191)
      • modified residue (238)
      • modified residue (286)
      • modified residue (311)
    Domains in SCOPe 2.08: d1opxa_
  • Chain 'B':
    Compound: virB11 homolog
    Species: HELICOBACTER PYLORI [TaxId:85962]
    Gene: hp0525
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7BK04
      • modified residue (41)
      • modified residue (81)
      • modified residue (191)
      • modified residue (238)
      • modified residue (286)
      • modified residue (311)
    Domains in SCOPe 2.08: d1opxb_
  • Heterogens: SO4, 2PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1opxA (A:)
    mtedrlsaedkkfleveralkeaalnplrhateelfgdflkmeniteicyngnkvvwvlk
    nngewqpfdvrdrkafslsrlmhfarccasfkkktidnyenpilssnlangervqivlsp
    vtvndetisisiripskttyphsffeeqgfynlldnkeqaisaikdgiaigknvivcggt
    gsgkttyiksimefipkeeriisiedteeivfkhhknytqlffggnitsadclksclrmr
    pdriilgelrsseaydfynvlcsghkgtlttlhagsseeafirlanmsssnsaarnikfe
    sliegfkdlidmivhinhhkqcdefyikhr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1opxA (A:)
    lsaedkkfleveralkeaalnplrhateelfgdflkmeniteicyngnkvvwvlknngew
    qpfdvrdrkafslsrlmhfarccasfkkktidnyenpilssnlangervqivlspvtvnd
    etisisiripskttyphsffeeqgfynlldnkeqaisaikdgiaigknvivcggtgsgkt
    tyiksimefipkeeriisiedteeivfkhhknytqlffggnitsadclksclrmrpdrii
    lgelrsseaydfynvlcsghkgtlttlhagsseeafirlanmsssnsaarnikfeslieg
    fkdlidmivhinhhkqcdefyik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1opxB (B:)
    mtedrlsaedkkfleveralkeaalnplrhateelfgdflkmeniteicyngnkvvwvlk
    nngewqpfdvrdrkafslsrlmhfarccasfkkktidnyenpilssnlangervqivlsp
    vtvndetisisiripskttyphsffeeqgfynlldnkeqaisaikdgiaigknvivcggt
    gsgkttyiksimefipkeeriisiedteeivfkhhknytqlffggnitsadclksclrmr
    pdriilgelrsseaydfynvlcsghkgtlttlhagsseeafirlanmsssnsaarnikfe
    sliegfkdlidmivhinhhkqcdefyikhr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1opxB (B:)
    lsaedkkfleveralkeaalnplrhateelfgdflkmeniteicyngnkvvwvlknngew
    qpfdvrdrkafslsrlmhfarccasfkkktidnyenpilssnlangervqivlspvtvnd
    etisisiripskttyphsffeeqgfynlldnkeqaisaikdgiaigknvivcggtgsgkt
    tyiksimefipkeeriisiedteeivfkhhknytqlffggnitsadclksclrmrpdrii
    lgelrsseaydfynvlcsghkgtlttlhagsseeafirlanmsssnsaarnikfeslieg
    fkdlidmivhinhhkqcdefyik