PDB entry 1opr

View 1opr on RCSB PDB site
Description: the crystal structure of the orotate phosphoribosyltransferase complexed with orotate and alpha-d-5-phosphoribosyl-1-pyrophosphate
Class: transferase
Keywords: transferase
Deposited on 1995-01-06, released 1996-01-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotate phosphoribosyltransferase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1opra_
  • Heterogens: MG, ORO, PRP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1oprA (A:)
mkpyqrqfiefalnkqvlkfgeftlksgrkspyffnaglfntgrdlallgrfyaealvds
giefdllfgpaykgipiatttavalaehhdkdlpycfnrkeakdhgeggslvgsalqgrv
mlvddvitagtairesmeiiqahgatlagvlisldrqergrgeisaiqeverdygckvis
iitlkdliayleekpdmaehlaavrayreefgv