PDB entry 1opm

View 1opm on RCSB PDB site
Description: oxidized (cu2+) peptidylglycine alpha-hydroxylating monooxygenase (phm) with bound substrate
Deposited on 1999-05-25, released 1999-09-29
The last revision prior to the SCOP 1.55 freeze date was dated 1999-09-29, with a file datestamp of 1999-09-28.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.2
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1opma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1opmA (A:)
    neclgtigpvtpldasdfaldirmpgvtpkesdtyfcmsmrlpvdeeafvidfkprasmd
    tvhhmllfgcnmpsstgsywfcdegtctdkanilyawarnapptrlpkgvgfrvggetgs
    kyfvlqvhygdisafrdnhkdcsgvsvhltrvpqpliagmylmmsvdtvippgekvvnad
    iscqykmypmhvfayrvhthhlgkvvsgyrvrngqwtligrqnpqlpqafypvehpvdvt
    fgdilaarcvftgegrteathiggtssdemcnlyimyymeakyalsfmtctknvapdmfr
    tipaeanipi