PDB entry 1opi

View 1opi on RCSB PDB site
Description: solution structure of the third rna recognition motif (rrm) of u2af65 in complex with an n-terminal sf1 peptide
Deposited on 2003-03-05, released 2004-03-16
The last revision prior to the SCOP 1.67 freeze date was dated 2004-03-16, with a file datestamp of 2004-03-16.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1opia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1opiA (A:)
    ghptevlclmnmvlpeellddeeyeeivedvrdecskyglvksieiprpvdgvevpgcgk
    ifveftsvfdcqkamqgltgrkfanrvvvtkycdpdsyhrrdfw