PDB entry 1oph

View 1oph on RCSB PDB site
Description: non-covalent complex between alpha-1-pi-pittsburgh and s195a trypsin
Class: hydrolase/hydrolase inhibitor
Keywords: serine proteinase inhibitor, michaelis-like complex, serpin, alpha-1 antitrypsin, trypsin, hydrolase/hydrolase inhibitor complex
Deposited on 2003-03-05, released 2003-08-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.19
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-1-antitrypsin precursor
    Species: Homo sapiens [TaxId:9606]
    Gene: SERPINA1 OR PI OR AAT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01009 (Start-393)
      • engineered (50)
      • engineered (58)
      • engineered (67)
      • engineered (69)
      • engineered (231)
      • engineered (357)
      • engineered (373)
      • engineered (380)
      • engineered (386)
    Domains in SCOPe 2.06: d1opha_
  • Chain 'B':
    Compound: Trypsinogen, cationic precursor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00760 (Start-242)
      • engineered (196)
    Domains in SCOPe 2.06: d1ophb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ophA (A:)
    mdpqgdaaqktdtshhdqdhptfnkitpnlaefafslyrqlahqsnstnilfspvsiaaa
    famlslgakgdthdeileglnfnlteipeaqihegfqellrtlnqpdsqlqlttgnglfl
    seglklvdkfledvkklyhseaftvnfgdteeakkqindyvekgtqgkivdlvkeldrdt
    vfalvnyiffkgkwerpfevkdteeedfhvdqvttvkvpmmkrlgmfniqhskklsswvl
    lmkylgnataifflpdegklqhlenelthdiitkflenedrrsaslhlpklsitgtydlk
    svlgqlgitkvfsngadlsgvteeaplklskavhkavltidekgteaagamfleaiprsi
    ppevkfnkpfvfliieqntkaplfmgrvvnptqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ophA (A:)
    hptfnkitpnlaefafslyrqlahqsnstnilfspvsiaaafamlslgakgdthdeileg
    lnfnlteipeaqihegfqellrtlnqpdsqlqlttgnglflseglklvdkfledvkklyh
    seaftvnfgdteeakkqindyvekgtqgkivdlvkeldrdtvfalvnyiffkgkwerpfe
    vkdteeedfhvdqvttvkvpmmkrlgmfniqhskklsswvllmkylgnataifflpdegk
    lqhlenelthdiitkflenedrrsaslhlpklsitgtydlksvlgqlgitkvfsngadls
    gvteeaplklskavhkavltidekgteaagamfleaiprsippevkfnkpfvfliieqnt
    kaplfmgrvvnptqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ophB (B:)
    fiflallgaavafpvddddkivggytcgantvpyqvslnsgyhfcggslinsqwvvsaah
    cyksgiqvrlgedninvvegneqfisasksivhpsynsntlnndimliklksaaslnsrv
    asislptscasagtqclisgwgntkssgtsypdvlkclkapilsdsscksaypgqitsnm
    fcagyleggkdscqgdaggpvvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqti
    asn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ophB (B:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdaggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn