PDB entry 1opg

View 1opg on RCSB PDB site
Description: opg2 fab fragment
Class: immunoglobulin
Keywords: cell adhesion molecule
Deposited on 1995-04-28, released 1995-07-31
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.16
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: opg2 fab (heavy chain)
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1opgh1, d1opgh2
  • Chain 'L':
    Compound: opg2 fab (light chain)
    Species: HOMO SAPIENS
    Domains in SCOP 1.73: d1opgl1, d1opgl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1opgH (H:)
    evqlvqsggglvnpgrslklscaasgftfssygmswvrqtpekrlewvaaisgggtyihy
    pdsvkgrftisrdnaknnlylqmsslrsedtalyyctrhpfyrydggnyyamdhwgqgts
    vtvsaakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpa
    vlqsdlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1opgL (L:)
    delltqspatlsvtpgdsvslscrasqsisnnlhwyqqkshesprllikyasqsisgips
    rfsgsgsgtdftlsinsvetedfgmyfcqqsnswpltfgggskleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec