PDB entry 1opc

View 1opc on RCSB PDB site
Description: ompr DNA-binding domain, escherichia coli
Class: transcription regulation
Keywords: transcription regulation, response regulator, winged helix, osmoregulation
Deposited on 1996-12-16, released 1997-04-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.228
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ompr
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1opca_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1opcA (A:)
apsqeeaviafgkfklnlgtremfredepmpltsgefavlkalvshpreplsrdklmnla
rgreysamersidvqisrlrrmveedpahpryiqtvwglgyvfvpdgska

    Sequence, based on observed residues (ATOM records): (download) 
    >1opcA (A:)
viafgkfklnlgtremfredepmpltsgefavlkalvshpreplsrdklmnlargreysa
mersidvqisrlrrmveedpahpryiqtvwglgyvfvpd