PDB entry 1op9

View 1op9 on RCSB PDB site
Description: Complex of human lysozyme with camelid VHH HL6 antibody fragment
Class: hydrolase
Keywords: antigen-antibody complex, immunoglobulin, amyloid fibril formation inhibition, HYDROLASE
Deposited on 2003-03-05, released 2003-10-14
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.197
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HL6 camel VHH fragment
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OP9 (0-120)
    Domains in SCOPe 2.02: d1op9a_
  • Chain 'B':
    Compound: Lysozyme C
    Species: Homo sapiens [TaxId:9606]
    Gene: LYZ OR LZM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1op9b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1op9A (A:)
    qvqlqesgggsvqaggslrlscsasgytyisgwfrqapgkeregvaairssdgttyyads
    vkgrftisqdnakntvylqmnslkpedtamyycaatevagwpldigiydywgqgtevtvs
    s
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1op9B (B:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv