PDB entry 1oow

View 1oow on RCSB PDB site
Description: The crystal structure of the spinach plastocyanin double mutant G8D/L12E gives insight into its low reactivity towards photosystem 1 and cytochrome f
Class: electron transport, membrane
Keywords: cupredoxin, beta sandwich
Deposited on 2003-03-04, released 2004-02-17
The last revision prior to the SCOP 1.73 freeze date was dated 2004-08-24, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.188
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Plastocyanin, chloroplast
  Species: Spinacia oleracea
  Gene: PETE
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00289 (0-98)
    • engineered (7)
    • engineered (11)
  Domains in SCOP 1.73: d1oowa_
• Heterogens: CU, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1oowA (A:)
  vevllggddgseaflpgdfsvasgeeivfknnagfphnvvfdedeipsgvdaakismsee
  dllnapgetykvtltekgtykfycsphqgagmvgkvtvn