PDB entry 1oow

View 1oow on RCSB PDB site
Description: the crystal structure of the spinach plastocyanin double mutant g8d/l12e gives insight into its low reactivity towards photosystem 1 and cytochrome f
Deposited on 2003-03-04, released 2004-02-17
The last revision prior to the SCOP 1.69 freeze date was dated 2004-02-17, with a file datestamp of 2004-02-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.188
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1oowa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oowA (A:)
    vevllggddgseaflpgdfsvasgeeivfknnagfphnvvfdedeipsgvdaakismsee
    dllnapgetykvtltekgtykfycsphqgagmvgkvtvn