PDB entry 1ooh

View 1ooh on RCSB PDB site
Description: Complex of Drosophila odorant binding protein LUSH with butanol
Class: transport protein
Keywords: LUSH, Alcohol, Odorant Binding
Deposited on 2003-03-03, released 2003-09-02
The last revision prior to the SCOP 1.73 freeze date was dated 2003-09-02, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.163
AEROSPACI score: 0.8 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: odorant binding protein LUSH
    Species: Drosophila melanogaster
    Gene: lush
    Database cross-references and differences (RAF-indexed):
    • Uniprot O02372 (2-125)
      • cloning artifact (0-1)
    Domains in SCOP 1.73: d1ooha_
  • Chain 'B':
    Compound: odorant binding protein LUSH
    Species: Drosophila melanogaster
    Gene: lush
    Database cross-references and differences (RAF-indexed):
    • Uniprot O02372 (2-125)
      • cloning artifact (0-1)
    Domains in SCOP 1.73: d1oohb_
  • Heterogens: ACT, 1BO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oohA (A:)
    shmtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvslmagtv
    nkkgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenad
    gqfmwp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oohB (B:)
    shmtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvslmagtv
    nkkgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenad
    gqfmwp