PDB entry 1oof

View 1oof on RCSB PDB site
Description: Complex of Drosophila odorant binding protein LUSH with ethanol
Class: transport protein
Keywords: LUSH, Alcohol, Odorant Binding, TRANSPORT PROTEIN
Deposited on 2003-03-03, released 2003-09-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: 0.181
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: odorant binding protein LUSH
  Species: Drosophila melanogaster [TaxId:7227]
  Gene: lush
  Database cross-references and differences (RAF-indexed):
  • Uniprot O02372 (0-123)
  Domains in SCOPe 2.06: d1oofa_
• Chain 'B':
  Compound: odorant binding protein LUSH
  Species: Drosophila melanogaster [TaxId:7227]
  Gene: lush
  Database cross-references and differences (RAF-indexed):
  • Uniprot O02372 (0-123)
  Domains in SCOPe 2.06: d1oofb_
• Heterogens: ACT, EOH, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1oofA (A:)
  mtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvslmagtvnk
  kgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenadgq
  fmwp
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1oofB (B:)
  mtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvslmagtvnk
  kgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenadgq
  fmwp