PDB entry 1oof

View 1oof on RCSB PDB site
Description: Complex of Drosophila odorant binding protein LUSH with ethanol
Deposited on 2003-03-03, released 2003-09-02
The last revision prior to the SCOP 1.67 freeze date was dated 2003-09-02, with a file datestamp of 2003-09-02.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: 0.181
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1oofa_
  • Chain 'B':
    Domains in SCOP 1.67: d1oofb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oofA (A:)
    mtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvslmagtvnk
    kgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenadgq
    fmwp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oofB (B:)
    mtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvslmagtvnk
    kgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenadgq
    fmwp