PDB entry 1ooc

View 1ooc on RCSB PDB site
Description: Mutations in the T1.5 loop of pectate lyase A
Class: lyase
Keywords: parallel beta helix
Deposited on 2003-03-03, released 2004-03-16
The last revision prior to the SCOP 1.73 freeze date was dated 2004-03-16, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.94 Å
R-factor: 0.219
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pectate lyase A
    Species: Erwinia chrysanthemi
    Gene: PELA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29155 (0-360)
      • engineered (214)
      • engineered (216)
      • engineered (218-219)
    Domains in SCOP 1.73: d1ooca_
  • Chain 'B':
    Compound: pectate lyase A
    Species: Erwinia chrysanthemi
    Gene: PELA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29155 (0-360)
      • engineered (214)
      • engineered (216)
      • engineered (218-219)
    Domains in SCOP 1.73: d1oocb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oocA (A:)
    aelvsdkalesaptvgwasqngfttggaaatsdniyivtniseftsalsagaeakiiqik
    gtidisggtpytdfadqkarsqinipanttviglgtdakfingsliidgtdgtnnviirn
    vyiqtpidvephyekgdgwnaewdamnitngahhvwidhvtisdgnftddmyttkdgety
    vqhdgaldikrgsdyvtisnslidqhdktmlighsdsngsqdkgklhvtlfnnvfnrvte
    raprvrygsihsfnnvfkgdakdpvyryqysfgigtsgsvlsegnsftianlsaskackv
    vkkfngsifsdngsvlngsavdlsgcgfsaytskipyiydvqpmttelaqsitdnagsgk
    l
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oocB (B:)
    aelvsdkalesaptvgwasqngfttggaaatsdniyivtniseftsalsagaeakiiqik
    gtidisggtpytdfadqkarsqinipanttviglgtdakfingsliidgtdgtnnviirn
    vyiqtpidvephyekgdgwnaewdamnitngahhvwidhvtisdgnftddmyttkdgety
    vqhdgaldikrgsdyvtisnslidqhdktmlighsdsngsqdkgklhvtlfnnvfnrvte
    raprvrygsihsfnnvfkgdakdpvyryqysfgigtsgsvlsegnsftianlsaskackv
    vkkfngsifsdngsvlngsavdlsgcgfsaytskipyiydvqpmttelaqsitdnagsgk
    l