PDB entry 1oo9

View 1oo9 on RCSB PDB site
Description: Orientation in Solution of MMP-3 Catalytic Domain and N-TIMP-1 from Residual Dipolar Couplings
Class: hydrolase
Keywords: protein-protein complex
Deposited on 2003-03-03, released 2003-07-29
The last revision prior to the SCOP 1.75 freeze date was dated 2003-07-29, with a file datestamp of 2007-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: stromelysin-1
    Species: HOMO SAPIENS
    Gene: MMP3 OR STMY1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1oo9a_
  • Chain 'B':
    Compound: Metalloproteinase inhibitor 1
    Species: HOMO SAPIENS
    Gene: TIMP1 OR TIMP OR CLGI
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1oo9b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oo9A (A:)
    frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
    misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
    ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygppp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oo9B (B:)
    ctcvpphpqtafcnsdlvirakfvgtpevnqttlyqryeikmtkmykgfqalgdaadirf
    vytpamesvcgyfhrshnrseefliagklqdgllhittcsfvapwnslslaqrrgftkty
    tvgcee