PDB entry 1oo2

View 1oo2 on RCSB PDB site
Description: Crystal structure of transthyretin from Sparus aurata
Class: transport protein
Keywords: Transthyretin, retinol-binding protein, tetramer, TRANSPORT PROTEIN
Deposited on 2003-03-03, released 2004-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: 0.194
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Sparus aurata [TaxId:8175]
    Gene: TTR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1oo2a_
  • Chain 'B':
    Compound: Transthyretin
    Species: Sparus aurata [TaxId:8175]
    Gene: TTR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1oo2b_
  • Chain 'C':
    Compound: Transthyretin
    Species: Sparus aurata [TaxId:8175]
    Gene: TTR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1oo2c_
  • Chain 'D':
    Compound: Transthyretin
    Species: Sparus aurata [TaxId:8175]
    Gene: TTR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1oo2d_
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oo2A (A:)
    rcplmvkildavkgtpagsvalkvsqktadggwtqiatgvtdatgeihnliteqqfpagv
    yrvefdtkaywtnqgstpfhevaevvfdahpeghghytlalllspfsytttavvssvhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oo2A (A:)
    rcplmvkildavkgtpagsvalkvsqktadggwtqiatgvtdatgeihnliteqqfpagv
    yrvefdtkaywtnqgstpfhevaevvfdahpeghghytlalllspfsytttavvss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oo2B (B:)
    rcplmvkildavkgtpagsvalkvsqktadggwtqiatgvtdatgeihnliteqqfpagv
    yrvefdtkaywtnqgstpfhevaevvfdahpeghghytlalllspfsytttavvssvhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oo2B (B:)
    rcplmvkildavkgtpagsvalkvsqktadggwtqiatgvtdatgeihnliteqqfpagv
    yrvefdtkaywtnqgstpfhevaevvfdahpeghghytlalllspfsytttavvss
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1oo2C (C:)
    rcplmvkildavkgtpagsvalkvsqktadggwtqiatgvtdatgeihnliteqqfpagv
    yrvefdtkaywtnqgstpfhevaevvfdahpeghghytlalllspfsytttavvssvhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oo2C (C:)
    rcplmvkildavkgtpagsvalkvsqktadggwtqiatgvtdatgeihnliteqqfpagv
    yrvefdtkaywtnqgstpfhevaevvfdahpeghghytlalllspfsytttavvss
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1oo2D (D:)
    rcplmvkildavkgtpagsvalkvsqktadggwtqiatgvtdatgeihnliteqqfpagv
    yrvefdtkaywtnqgstpfhevaevvfdahpeghghytlalllspfsytttavvssvhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oo2D (D:)
    rcplmvkildavkgtpagsvalkvsqktadggwtqiatgvtdatgeihnliteqqfpagv
    yrvefdtkaywtnqgstpfhevaevvfdahpeghghytlalllspfsytttavvss