PDB entry 1oo0

View 1oo0 on RCSB PDB site
Description: Crystal structure of the Drosophila Mago nashi-Y14 complex
Deposited on 2003-03-02, released 2003-05-27
The last revision prior to the SCOP 1.67 freeze date was dated 2003-05-27, with a file datestamp of 2003-05-27.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.215
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1oo0a_
  • Chain 'B':
    Domains in SCOP 1.67: d1oo0b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oo0A (A:)
    mstedfylryyvghkgkfgheflefefrpdgklryannsnykndtmirkeafvhqsvmee
    lkriiidseimqeddlpwpppdrvgrqeleivigdehisfttsktgslvdvnrskdpegl
    rcfyylvqdlkclvfsliglhfkikpi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oo0A (A:)
    edfylryyvghkgkfgheflefefrpdgklryannsnykndtmirkeafvhqsvmeelkr
    iiidseimqeddlpwpppdrvgrqeleivigdehisfttsktgslvdvnrskdpeglrcf
    yylvqdlkclvfsliglhfkikpi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oo0B (B:)
    aihsyervrnedddelepgpqrsvegwilfvtsiheeaqedeiqekfcdygeiknihlnl
    drrtgfskgyalveyethkqalaakealngaeimgqtiqvdwcfvkgpkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oo0B (B:)
    pgpqrsvegwilfvtsiheeaqedeiqekfcdygeiknihlnldrrtgfskgyalveyet
    hkqalaakealngaeimgqtiqvdwcfvkgpk