PDB entry 1onx

View 1onx on RCSB PDB site
Description: Crystal structure of isoaspartyl dipeptidase from escherichia coli complexed with aspartate
Class: hydrolase
Keywords: amidohydrolase, hydrolase, metalloprotease
Deposited on 2003-03-02, released 2003-05-06
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.182
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Isoaspartyl dipeptidase
    Species: Escherichia coli [TaxId:562]
    Gene: IADA OR B4328
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1onxa1, d1onxa2
  • Chain 'B':
    Compound: Isoaspartyl dipeptidase
    Species: Escherichia coli [TaxId:562]
    Gene: IADA OR B4328
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1onxb1, d1onxb2
  • Heterogens: ZN, ASP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1onxA (A:)
    midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil
    cpgfidqhvhliggggeagpttrtpevalsrlteagvtsvvgllgtdsisrhpesllakt
    ralneegisawmltgayhvpsrtitgsvekdvaiidrvigvkcaisdhrsaapdvyhlan
    maaesrvggllggkpgvtvfhmgdskkalqpiydllencdvpiskllpthvnrnvplfeq
    alefarkggtiditssidepvapaegiaravqagiplarvtlssdgngsqpffddegnlt
    higvagfetlletvqvlvkdydfsisdalrpltssvagflnltgkgeilpgndadllvmt
    pelrieqvyargklmvkdgkacvkgtfeta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1onxA (A:)
    midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil
    cpgfidqhvhliggggeagpttrtpevalsrlteagvtsvvgllgtdsisrhpesllakt
    ralneegisawmltgayhvpsrtitgsvekdvaiidrvigvkcaisdhrsaapdvyhlan
    maaesrvggllggkpgvtvfhmgdskkalqpiydllencdvpiskllpthvnrnvplfeq
    alefarkggtiditssidepvapaegiaravqagiplarvtlssdgngsqpffddegnlt
    higvagfetlletvqvlvkdydfsisdalrpltssvagflnltgkgeilpgndadllvmt
    pelrieqvyargklmvkdgkacvkgtfet
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1onxB (B:)
    midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil
    cpgfidqhvhliggggeagpttrtpevalsrlteagvtsvvgllgtdsisrhpesllakt
    ralneegisawmltgayhvpsrtitgsvekdvaiidrvigvkcaisdhrsaapdvyhlan
    maaesrvggllggkpgvtvfhmgdskkalqpiydllencdvpiskllpthvnrnvplfeq
    alefarkggtiditssidepvapaegiaravqagiplarvtlssdgngsqpffddegnlt
    higvagfetlletvqvlvkdydfsisdalrpltssvagflnltgkgeilpgndadllvmt
    pelrieqvyargklmvkdgkacvkgtfeta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1onxB (B:)
    midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil
    cpgfidqhvhliggggeagpttrtpevalsrlteagvtsvvgllgtdsisrhpesllakt
    ralneegisawmltgayhvpsrtitgsvekdvaiidrvigvkcaisdhrsaapdvyhlan
    maaesrvggllggkpgvtvfhmgdskkalqpiydllencdvpiskllpthvnrnvplfeq
    alefarkggtiditssidepvapaegiaravqagiplarvtlssdgngsqpffddegnlt
    higvagfetlletvqvlvkdydfsisdalrpltssvagflnltgkgeilpgndadllvmt
    pelrieqvyargklmvkdgkacvkgtfet