PDB entry 1onw

View 1onw on RCSB PDB site
Description: Crystal structure of Isoaspartyl Dipeptidase from E. coli
Class: hydrolase
Keywords: amidohydrolase, hydrolase, metalloprotease
Deposited on 2003-03-02, released 2003-05-06
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.182
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Isoaspartyl dipeptidase
    Species: Escherichia coli [TaxId:562]
    Gene: IADA OR B4328
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39377 (0-End)
      • modified residue (161)
    Domains in SCOPe 2.04: d1onwa1, d1onwa2
  • Chain 'B':
    Compound: Isoaspartyl dipeptidase
    Species: Escherichia coli [TaxId:562]
    Gene: IADA OR B4328
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39377 (0-End)
      • modified residue (161)
    Domains in SCOPe 2.04: d1onwb1, d1onwb2
  • Heterogens: ZN, MG, NA, CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1onwA (A:)
    midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil
    cpgfidqhvhliggggeagpttrtpevalsrlteagvtsvvgllgtdsisrhpesllakt
    ralneegisawmltgayhvpsrtitgsvekdvaiidrvigvkcaisdhrsaapdvyhlan
    maaesrvggllggkpgvtvfhmgdskkalqpiydllencdvpiskllpthvnrnvplfeq
    alefarkggtiditssidepvapaegiaravqagiplarvtlssdgngsqpffddegnlt
    higvagfetlletvqvlvkdydfsisdalrpltssvagflnltgkgeilpgndadllvmt
    pelrieqvyargklmvkdgkacvkgtfeta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1onwA (A:)
    midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil
    cpgfidqhvhliggggeagpttrtpevalsrlteagvtsvvgllgtdsisrhpesllakt
    ralneegisawmltgayhvpsrtitgsvekdvaiidrvigvkcaisdhrsaapdvyhlan
    maaesrvggllggkpgvtvfhmgdskkalqpiydllencdvpiskllpthvnrnvplfeq
    alefarkggtiditssidepvapaegiaravqagiplarvtlssdgngsgvagfetllet
    vqvlvkdydfsisdalrpltssvagflnltgkgeilpgndadllvmtpelrieqvyargk
    lmvkdgkacvkgtfet
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1onwB (B:)
    midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil
    cpgfidqhvhliggggeagpttrtpevalsrlteagvtsvvgllgtdsisrhpesllakt
    ralneegisawmltgayhvpsrtitgsvekdvaiidrvigvkcaisdhrsaapdvyhlan
    maaesrvggllggkpgvtvfhmgdskkalqpiydllencdvpiskllpthvnrnvplfeq
    alefarkggtiditssidepvapaegiaravqagiplarvtlssdgngsqpffddegnlt
    higvagfetlletvqvlvkdydfsisdalrpltssvagflnltgkgeilpgndadllvmt
    pelrieqvyargklmvkdgkacvkgtfeta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1onwB (B:)
    midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil
    cpgfidqhvhliggggeagpttrtpevalsrlteagvtsvvgllgtdsisrhpesllakt
    ralneegisawmltgayhvpsrtitgsvekdvaiidrvigvkcaisdhrsaapdvyhlan
    maaesrvggllggkpgvtvfhmgdskkalqpiydllencdvpiskllpthvnrnvplfeq
    alefarkggtiditssidepvapaegiaravqagiplarvtlssdgngsqphigvagfet
    lletvqvlvkdydfsisdalrpltssvagflnltgkgeilpgndadllvmtpelrieqvy
    argklmvkdgkacvkgtfet