PDB entry 1ono

View 1ono on RCSB PDB site
Description: IspC Mn2+ complex
Class: oxidoreductase
Keywords: isoprenoid biosynthesis, mevalonate-independent pathway, IspC, oxidoreductase
Deposited on 2003-02-28, released 2003-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.216
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1-deoxy-D-xylulose 5-phosphate reductoisomerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1onoa1, d1onoa2, d1onoa3
  • Chain 'B':
    Compound: 1-deoxy-D-xylulose 5-phosphate reductoisomerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1onob1, d1onob2, d1onob3
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1onoA (A:)
    mkqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefspryavmddea
    sakllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllptlaairagkti
    llankeslvtcgrlfmdavkqskaqllpvdsehnaifqslpqpiqhnlgyadleqngvvs
    illtgsggpfretplrdlatmtpdqacrhpnwsmgrkisvdsatmmnkgleyiearwlfn
    asasqmevlihpqsvihsmvryqdgsvlaqlgepdmrtpiahtmawpnrvnsgvkpldfc
    klsaltfaapdydrypclklameafeqgqaattalnaaneitvaaflaqqirftdiaaln
    lsvlekmdmrepqcvddvlsvdanarevarkevmrlas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1onoA (A:)
    mkqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefspryavmddea
    sakllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllptlaairagkti
    llankeslvtcgrlfmdavkqskaqllpvdsehnaifqslpqpiqhnlgyadleqngvvs
    illtgsggpfretplrdlatmtpdqacrkisvdsatmmnkgleyiearwlfnasasqmev
    lihpqsvihsmvryqdgsvlaqlgepdmrtpiahtmawpnrvnsgvkpldfcklsaltfa
    apdydrypclklameafeqgqaattalnaaneitvaaflaqqirftdiaalnlsvlekmd
    mrepqcvddvlsvdanarevarkevmrla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1onoB (B:)
    mkqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefspryavmddea
    sakllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllptlaairagkti
    llankeslvtcgrlfmdavkqskaqllpvdsehnaifqslpqpiqhnlgyadleqngvvs
    illtgsggpfretplrdlatmtpdqacrhpnwsmgrkisvdsatmmnkgleyiearwlfn
    asasqmevlihpqsvihsmvryqdgsvlaqlgepdmrtpiahtmawpnrvnsgvkpldfc
    klsaltfaapdydrypclklameafeqgqaattalnaaneitvaaflaqqirftdiaaln
    lsvlekmdmrepqcvddvlsvdanarevarkevmrlas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1onoB (B:)
    mkqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefspryavmddea
    sakllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllptlaairagkti
    llankeslvtcgrlfmdavkqskaqllpvdsehnaifqslpqpiqhnlgyadleqngvvs
    illtgsggpfretplrdlatmtpdqacrkisvdsatmmnkgleyiearwlfnasasqmev
    lihpqsvihsmvryqdgsvlaqlgepdmrtpiahtmawpnrvnsgvkpldfcklsaltfa
    apdydrypclklameafeqgqaattalnaaneitvaaflaqqirftdiaalnlsvlekmd
    mrepqcvddvlsvdanarevarkevmrla