PDB entry 1onk

View 1onk on RCSB PDB site
Description: mistletoe lectin i from viscum album
Deposited on 2003-02-28, released 2004-02-28
The last revision prior to the SCOP 1.67 freeze date was dated 2004-02-28, with a file datestamp of 2004-02-28.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.172
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1onkA (A:)
    yerlrlrvthqttgeeyfrfitllrdyvssgsfsneipllrqstipvsdaqrfvlveltn
    qgqdsvtaaidvtnayvvayqagdqsyflrdaprgaethlftgttrsslpfngsypdler
    yaghrdqiplgidqliqsvtalrfpggstrtqarsililiqmiseaarfnpilwryrqyi
    nsgasflpdvymleletswgqqstqvqhstdgvfnnpirlaippgnfvtltnvrdviasl
    aimlfvcgerpsss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1onkA (A:)
    yerlrlrvthqttgeeyfrfitllrdyvssgsfsneipllrqstipvsdaqrfvlveltn
    qgqdsvtaaidvtnayvvayqagdqsyflrdaprgaethlftgttrsslpfngsypdler
    yaghrdqiplgidqliqsvtalrfpggstrtqarsililiqmiseaarfnpilwryrqyi
    nsgasflpdvymleletswgqqstqvqhstdgvfnnpirlaippgnfvtltnvrdviasl
    aimlfvcge
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1onkB (B:)
    ddvtcsaseptvrivgrngmrvdvrdddfhdgnqiqlwpsksnndpnqlwtikrdgtirs
    ngsclttygytagvyvmifdcntavreatiwqiwdngtiinprsnlvlaassgikgttlt
    vqtldytlgqgwlagndtaprevtiygfrdlcmesnggsvwvetcdssqknqkwalygdg
    sirpkqnqdqcltsgrdsvstvinivscsgasgsqrwvftnegailnlknglamdvaqan
    pklrriiiypatgkpnqmwlpvf