PDB entry 1onk

View 1onk on RCSB PDB site
Description: Mistletoe lectin I from viscum album
Class: hydrolase/sugar binding protein
Keywords: RIBOSOME-INACTIVATING PROTEIN TYPE II, hydrolase-sugar binding protein COMPLEX
Deposited on 2003-02-28, released 2004-02-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-galactoside specific lectin I A chain
    Species: Viscum album [TaxId:3972]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1onka_
  • Chain 'B':
    Compound: Galactose specific lectin I B chain
    Species: Viscum album [TaxId:3972]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1onkb1, d1onkb2
  • Heterogens: PO4, AZI, GOL, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1onkA (A:)
    yerlrlrvthqttgeeyfrfitllrdyvssgsfsneipllrqstipvsdaqrfvlveltn
    qgqdsvtaaidvtnayvvayqagdqsyflrdaprgaethlftgttrsslpfngsypdler
    yaghrdqiplgidqliqsvtalrfpggstrtqarsililiqmiseaarfnpilwryrqyi
    nsgasflpdvymleletswgqqstqvqhstdgvfnnpirlaippgnfvtltnvrdviasl
    aimlfvcgerpsss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1onkA (A:)
    yerlrlrvthqttgeeyfrfitllrdyvssgsfsneipllrqstipvsdaqrfvlveltn
    qgqdsvtaaidvtnayvvayqagdqsyflrdaprgaethlftgttrsslpfngsypdler
    yaghrdqiplgidqliqsvtalrfpggstrtqarsililiqmiseaarfnpilwryrqyi
    nsgasflpdvymleletswgqqstqvqhstdgvfnnpirlaippgnfvtltnvrdviasl
    aimlfvcge
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1onkB (B:)
    ddvtcsaseptvrivgrngmrvdvrdddfhdgnqiqlwpsksnndpnqlwtikrdgtirs
    ngsclttygytagvyvmifdcntavreatiwqiwdngtiinprsnlvlaassgikgttlt
    vqtldytlgqgwlagndtaprevtiygfrdlcmesnggsvwvetcdssqknqkwalygdg
    sirpkqnqdqcltsgrdsvstvinivscsgasgsqrwvftnegailnlknglamdvaqan
    pklrriiiypatgkpnqmwlpvf