PDB entry 1onc

View 1onc on RCSB PDB site
Description: the refined 1.7 angstroms x-ray crystallographic structure of p-30, an amphibian ribonuclease with anti-tumor activity
Class: pancreatic ribonuclease
Keywords: pancreatic ribonuclease
Deposited on 1993-08-30, released 1994-01-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.178
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: P-30 protein
    Species: Rana pipiens [TaxId:8404]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1onca_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oncA (A:)
    edwltfqkkhitntrdvdcdnimstnlfhckdkntfiysrpepvkaickgiiasknvltt
    sefylsdcnvtsrpckyklkkstnkfcvtcenqapvhfvgvgsc