PDB entry 1onc

View 1onc on RCSB PDB site
Description: the refined 1.7 angstroms x-ray crystallographic structure of p-30, an amphibian ribonuclease with anti-tumor activity
Class: pancreatic ribonuclease
Keywords: pancreatic ribonuclease
Deposited on 1993-08-30, released 1994-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: P-30 protein
  Species: Rana pipiens [TaxId:8404]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22069 (1-103)
  Domains in SCOPe 2.08: d1onca1, d1onca2
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1oncA (A:)
  edwltfqkkhitntrdvdcdnimstnlfhckdkntfiysrpepvkaickgiiasknvltt
  sefylsdcnvtsrpckyklkkstnkfcvtcenqapvhfvgvgsc