SCOPe 2.06: Structural Classification of Proteins

PDB entry 1on9

View 1on9 on RCSB PDB site
Description: Transcarboxylase 12S crystal structure: hexamer assembly and substrate binding to a multienzyme core (with hydrolyzed methylmalonyl-coenzyme a bound)
Class: transferase
Keywords: carboxyl transferase, domain duplication, multienzyme complex, transcarboxylase, TRANSFERASE
Deposited on 2003-02-27, released 2003-05-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.152
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Methylmalonyl-CoA carboxyltransferase 12S subunit
Species: Propionibacterium freudenreichii [TaxId:1744]
Database cross-references and differences (RAF-indexed):
- Uniprot Q8GBW6 (Start-522)
Domains in SCOPe 2.06: d1on9a1, d1on9a2
Chain 'B':
Compound: Methylmalonyl-CoA carboxyltransferase 12S subunit
Species: Propionibacterium freudenreichii [TaxId:1744]
Database cross-references and differences (RAF-indexed):
- Uniprot Q8GBW6 (Start-522)
Domains in SCOPe 2.06: d1on9b1, d1on9b2
Chain 'C':
Compound: Methylmalonyl-CoA carboxyltransferase 12S subunit
Species: Propionibacterium freudenreichii [TaxId:1744]
Database cross-references and differences (RAF-indexed):
- Uniprot Q8GBW6 (Start-522)
Domains in SCOPe 2.06: d1on9c1, d1on9c2
Chain 'D':
Compound: Methylmalonyl-CoA carboxyltransferase 12S subunit
Species: Propionibacterium freudenreichii [TaxId:1744]
Database cross-references and differences (RAF-indexed):
- Uniprot Q8GBW6 (Start-522)
Domains in SCOPe 2.06: d1on9d1, d1on9d2
Chain 'E':
Compound: Methylmalonyl-CoA carboxyltransferase 12S subunit
Species: Propionibacterium freudenreichii [TaxId:1744]
Database cross-references and differences (RAF-indexed):
- Uniprot Q8GBW6 (Start-522)
Domains in SCOPe 2.06: d1on9e1, d1on9e2
Chain 'F':
Compound: Methylmalonyl-CoA carboxyltransferase 12S subunit
Species: Propionibacterium freudenreichii [TaxId:1744]
Database cross-references and differences (RAF-indexed):
- Uniprot Q8GBW6 (Start-522)
Domains in SCOPe 2.06: d1on9f1, d1on9f2
Heterogens: CD, MCA, MPD, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1on9A (A:)
aennnlklastmegrveqlaeqrqvieagggerrvekqhsqgkqtarerlnnlldphsfd
evgafrkhrttlfgmdkavvpadgvvtgrgtilgrpvhaasqdftvmggsagetqstkvv
etmeqalltgtpflffydsggariqegidslsgygkmffanvklsgvvpqiaiiagpcag
gasyspaltdfiimtkkahmfitgpqviksvtgedvtadelggaeahmaisgnihfvaed
ddaaeliakkllsflpqnnteeasfvnpnndvspntelrdivpidgkkgydvrdviakiv
dwgdylevkagyatnlvtafarvngrsvgivanqpsvmsgcldinasdkaaefvnfcdsf
niplvqlvdvpgflpgvqqeyggiirhgakmlyayseatvpkitvvlrkayggsylamcn
rdlgadavyawpsaeiavmgaegaanvifrkeikaaddpdamraekieeyqnafntpyva
aargqvddvidpadtrrkiasalemyatkrqtrpakkhgnfpc