PDB entry 1on9

View 1on9 on RCSB PDB site
Description: Transcarboxylase 12S crystal structure: hexamer assembly and substrate binding to a multienzyme core (with hydrolyzed methylmalonyl-coenzyme a bound)
Class: transferase
Keywords: carboxyl transferase, domain duplication, multienzyme complex, transcarboxylase, TRANSFERASE
Deposited on 2003-02-27, released 2003-05-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.152
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methylmalonyl-CoA carboxyltransferase 12S subunit
    Species: Propionibacterium freudenreichii [TaxId:1744]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1on9a1, d1on9a2
  • Chain 'B':
    Compound: Methylmalonyl-CoA carboxyltransferase 12S subunit
    Species: Propionibacterium freudenreichii [TaxId:1744]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1on9b1, d1on9b2
  • Chain 'C':
    Compound: Methylmalonyl-CoA carboxyltransferase 12S subunit
    Species: Propionibacterium freudenreichii [TaxId:1744]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1on9c1, d1on9c2
  • Chain 'D':
    Compound: Methylmalonyl-CoA carboxyltransferase 12S subunit
    Species: Propionibacterium freudenreichii [TaxId:1744]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1on9d1, d1on9d2
  • Chain 'E':
    Compound: Methylmalonyl-CoA carboxyltransferase 12S subunit
    Species: Propionibacterium freudenreichii [TaxId:1744]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1on9e1, d1on9e2
  • Chain 'F':
    Compound: Methylmalonyl-CoA carboxyltransferase 12S subunit
    Species: Propionibacterium freudenreichii [TaxId:1744]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1on9f1, d1on9f2
  • Heterogens: CD, MCA, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1on9A (A:)
    aennnlklastmegrveqlaeqrqvieagggerrvekqhsqgkqtarerlnnlldphsfd
    evgafrkhrttlfgmdkavvpadgvvtgrgtilgrpvhaasqdftvmggsagetqstkvv
    etmeqalltgtpflffydsggariqegidslsgygkmffanvklsgvvpqiaiiagpcag
    gasyspaltdfiimtkkahmfitgpqviksvtgedvtadelggaeahmaisgnihfvaed
    ddaaeliakkllsflpqnnteeasfvnpnndvspntelrdivpidgkkgydvrdviakiv
    dwgdylevkagyatnlvtafarvngrsvgivanqpsvmsgcldinasdkaaefvnfcdsf
    niplvqlvdvpgflpgvqqeyggiirhgakmlyayseatvpkitvvlrkayggsylamcn
    rdlgadavyawpsaeiavmgaegaanvifrkeikaaddpdamraekieeyqnafntpyva
    aargqvddvidpadtrrkiasalemyatkrqtrpakkhgnfpc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1on9A (A:)
    lastmegrveqlaeqrqvieagggerrvekqhsqgkqtarerlnnlldphsfdevgafrk
    hrttlfgmdkavvpadgvvtgrgtilgrpvhaasqdftvmggsagetqstkvvetmeqal
    ltgtpflffydsggariqegidslsgygkmffanvklsgvvpqiaiiagpcaggasyspa
    ltdfiimtkkahmfitgpqviksvtgedvtadelggaeahmaisgnihfvaedddaaeli
    akkllsflpqnnteeasfvnpnndvspntelrdivpidgkkgydvrdviakivdwgdyle
    vkagyatnlvtafarvngrsvgivanqpsvmsgcldinasdkaaefvnfcdsfniplvql
    vdvpgflpgvqqeyggiirhgakmlyayseatvpkitvvlrkayggsylamcnrdlgada
    vyawpsaeiavmgaegaanvifrkeikaaddpdamraekieeyqnafntpyvaaargqvd
    dvidpadtrrkiasalemyatkrqtrpakkhgnfpc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1on9B (B:)
    aennnlklastmegrveqlaeqrqvieagggerrvekqhsqgkqtarerlnnlldphsfd
    evgafrkhrttlfgmdkavvpadgvvtgrgtilgrpvhaasqdftvmggsagetqstkvv
    etmeqalltgtpflffydsggariqegidslsgygkmffanvklsgvvpqiaiiagpcag
    gasyspaltdfiimtkkahmfitgpqviksvtgedvtadelggaeahmaisgnihfvaed
    ddaaeliakkllsflpqnnteeasfvnpnndvspntelrdivpidgkkgydvrdviakiv
    dwgdylevkagyatnlvtafarvngrsvgivanqpsvmsgcldinasdkaaefvnfcdsf
    niplvqlvdvpgflpgvqqeyggiirhgakmlyayseatvpkitvvlrkayggsylamcn
    rdlgadavyawpsaeiavmgaegaanvifrkeikaaddpdamraekieeyqnafntpyva
    aargqvddvidpadtrrkiasalemyatkrqtrpakkhgnfpc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1on9B (B:)
    lastmegrveqlaeqrqvieagggerrvekqhsqgkqtarerlnnlldphsfdevgafrk
    hrttlfgmdkavvpadgvvtgrgtilgrpvhaasqdftvmggsagetqstkvvetmeqal
    ltgtpflffydsggariqegidslsgygkmffanvklsgvvpqiaiiagpcaggasyspa
    ltdfiimtkkahmfitgpqviksvtgedvtadelggaeahmaisgnihfvaedddaaeli
    akkllsflpqnnteeasfvnpnndvspntelrdivpidgkkgydvrdviakivdwgdyle
    vkagyatnlvtafarvngrsvgivanqpsvmsgcldinasdkaaefvnfcdsfniplvql
    vdvpgflpgvqqeyggiirhgakmlyayseatvpkitvvlrkayggsylamcnrdlgada
    vyawpsaeiavmgaegaanvifrkeikaaddpdamraekieeyqnafntpyvaaargqvd
    dvidpadtrrkiasalemyatkrqtrpakkhgnfpc
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1on9C (C:)
    aennnlklastmegrveqlaeqrqvieagggerrvekqhsqgkqtarerlnnlldphsfd
    evgafrkhrttlfgmdkavvpadgvvtgrgtilgrpvhaasqdftvmggsagetqstkvv
    etmeqalltgtpflffydsggariqegidslsgygkmffanvklsgvvpqiaiiagpcag
    gasyspaltdfiimtkkahmfitgpqviksvtgedvtadelggaeahmaisgnihfvaed
    ddaaeliakkllsflpqnnteeasfvnpnndvspntelrdivpidgkkgydvrdviakiv
    dwgdylevkagyatnlvtafarvngrsvgivanqpsvmsgcldinasdkaaefvnfcdsf
    niplvqlvdvpgflpgvqqeyggiirhgakmlyayseatvpkitvvlrkayggsylamcn
    rdlgadavyawpsaeiavmgaegaanvifrkeikaaddpdamraekieeyqnafntpyva
    aargqvddvidpadtrrkiasalemyatkrqtrpakkhgnfpc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1on9C (C:)
    klastmegrveqlaeqrqvieagggerrvekqhsqgkqtarerlnnlldphsfdevgafr
    khrttlfgmdkavvpadgvvtgrgtilgrpvhaasqdftvmggsagetqstkvvetmeqa
    lltgtpflffydsggariqegidslsgygkmffanvklsgvvpqiaiiagpcaggasysp
    altdfiimtkkahmfitgpqviksvtgedvtadelggaeahmaisgnihfvaedddaael
    iakkllsflpqnnteeasfvnpnndvspntelrdivpidgkkgydvrdviakivdwgdyl
    evkagyatnlvtafarvngrsvgivanqpsvmsgcldinasdkaaefvnfcdsfniplvq
    lvdvpgflpgvqqeyggiirhgakmlyayseatvpkitvvlrkayggsylamcnrdlgad
    avyawpsaeiavmgaegaanvikeiaaddpdamraekieeyqnafntpyvaaargqvddv
    idpadtrrkiasalemyatkrqtrpakkhgnfpc
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1on9D (D:)
    aennnlklastmegrveqlaeqrqvieagggerrvekqhsqgkqtarerlnnlldphsfd
    evgafrkhrttlfgmdkavvpadgvvtgrgtilgrpvhaasqdftvmggsagetqstkvv
    etmeqalltgtpflffydsggariqegidslsgygkmffanvklsgvvpqiaiiagpcag
    gasyspaltdfiimtkkahmfitgpqviksvtgedvtadelggaeahmaisgnihfvaed
    ddaaeliakkllsflpqnnteeasfvnpnndvspntelrdivpidgkkgydvrdviakiv
    dwgdylevkagyatnlvtafarvngrsvgivanqpsvmsgcldinasdkaaefvnfcdsf
    niplvqlvdvpgflpgvqqeyggiirhgakmlyayseatvpkitvvlrkayggsylamcn
    rdlgadavyawpsaeiavmgaegaanvifrkeikaaddpdamraekieeyqnafntpyva
    aargqvddvidpadtrrkiasalemyatkrqtrpakkhgnfpc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1on9D (D:)
    lklastmegrveqlaeqrqvieagggerrvekqhsqgkqtarerlnnlldphsfdevgaf
    rkhrttlfgmdkavvpadgvvtgrgtilgrpvhaasqdftvmggsagetqstkvvetmeq
    alltgtpflffydsggariqegidslsgygkmffanvklsgvvpqiaiiagpcaggasys
    paltdfiimtkkahmfitgpqviksvtgedvtadelggaeahmaisgnihfvaedddaae
    liakkllsflpqnnteeasfvnpnndvspntelrdivpidgkkgydvrdviakivdwgdy
    levkagyatnlvtafarvngrsvgivanqpsvmsgcldinasdkaaefvnfcdsfniplv
    qlvdvpgflpgvqqeyggiirhgakmlyayseatvpkitvvlrkayggsylamcnrdlga
    davyawpsaeiavmgaegaanvifamkieeyqnafntpyvaaargqvddvidpadtrrki
    asalemyatkrqtrpakkhgnfpc
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1on9E (E:)
    aennnlklastmegrveqlaeqrqvieagggerrvekqhsqgkqtarerlnnlldphsfd
    evgafrkhrttlfgmdkavvpadgvvtgrgtilgrpvhaasqdftvmggsagetqstkvv
    etmeqalltgtpflffydsggariqegidslsgygkmffanvklsgvvpqiaiiagpcag
    gasyspaltdfiimtkkahmfitgpqviksvtgedvtadelggaeahmaisgnihfvaed
    ddaaeliakkllsflpqnnteeasfvnpnndvspntelrdivpidgkkgydvrdviakiv
    dwgdylevkagyatnlvtafarvngrsvgivanqpsvmsgcldinasdkaaefvnfcdsf
    niplvqlvdvpgflpgvqqeyggiirhgakmlyayseatvpkitvvlrkayggsylamcn
    rdlgadavyawpsaeiavmgaegaanvifrkeikaaddpdamraekieeyqnafntpyva
    aargqvddvidpadtrrkiasalemyatkrqtrpakkhgnfpc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1on9E (E:)
    nlklastmegrveqlaeqrqvieagggerrvekqhsqgkqtarerlnnlldphsfdevga
    frkhrttlfgmdkavvpadgvvtgrgtilgrpvhaasqdftvmggsagetqstkvvetme
    qalltgtpflffydsggariqegidslsgygkmffanvklsgvvpqiaiiagpcaggasy
    spaltdfiimtkkahmfitgpqviksvtgedvtadelggaeahmaisgnihfvaedddaa
    eliakkllsflpqnnteeasfvnpnndvspntelrdivpidgkkgydvrdviakivdwgd
    ylevkagyatnlvtafarvngrsvgivanqpsvmsgcldinasdkaaefvnfcdsfnipl
    vqlvdvpgflpgvqqeyggiirhgakmlyayseatvpkitvvlrkayggsylamcnrdlg
    adavyawpsaeiavmgaegaanvifrkeikaaddpdamraekieeyqnafntpyvaaarg
    qvddvidpadtrrkiasalemyatkrqtrpakkhgnfpc
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1on9F (F:)
    aennnlklastmegrveqlaeqrqvieagggerrvekqhsqgkqtarerlnnlldphsfd
    evgafrkhrttlfgmdkavvpadgvvtgrgtilgrpvhaasqdftvmggsagetqstkvv
    etmeqalltgtpflffydsggariqegidslsgygkmffanvklsgvvpqiaiiagpcag
    gasyspaltdfiimtkkahmfitgpqviksvtgedvtadelggaeahmaisgnihfvaed
    ddaaeliakkllsflpqnnteeasfvnpnndvspntelrdivpidgkkgydvrdviakiv
    dwgdylevkagyatnlvtafarvngrsvgivanqpsvmsgcldinasdkaaefvnfcdsf
    niplvqlvdvpgflpgvqqeyggiirhgakmlyayseatvpkitvvlrkayggsylamcn
    rdlgadavyawpsaeiavmgaegaanvifrkeikaaddpdamraekieeyqnafntpyva
    aargqvddvidpadtrrkiasalemyatkrqtrpakkhgnfpc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1on9F (F:)
    lastmegrveqlaeqrqvieagggerrvekqhsqgkqtarerlnnlldphsfdevgafrk
    hrttlfgmdkavvpadgvvtgrgtilgrpvhaasqdftvmggsagetqstkvvetmeqal
    ltgtpflffydsggariqegidslsgygkmffanvklsgvvpqiaiiagpcaggasyspa
    ltdfiimtkkahmfitgpqviksvtgedvtadelggaeahmaisgnihfvaedddaaeli
    akkllsflpqnnteeasfvnpnndvspntelrdivpidgkkgydvrdviakivdwgdyle
    vkagyatnlvtafarvngrsvgivanqpsvmsgcldinasdkaaefvnfcdsfniplvql
    vdvpgflpgvqqeyggiirhgakmlyayseatvpkitvvlrkayggsylamcnrdlgada
    vyawpsaeiavmgaegaanvifrkeikaaddpdamraekieeyqnafntpyvaaargqvd
    dvidpadtrrkiasalemyatkrqtrpakkhgnfpc