PDB entry 1on6

View 1on6 on RCSB PDB site
Description: Crystal structure of mouse alpha-1,4-N-acetylhexosaminotransferase (EXTL2) in complex with UDPGlcNAc
Class: transferase
Keywords: Rossmann fold, DXD motif, TRANSFERASE
Deposited on 2003-02-27, released 2003-04-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-1,4-N-acetylhexosaminyltransferase EXTL2
    Species: Mus musculus [TaxId:10090]
    Gene: EXTL2 OR EXTR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1on6a_
  • Chain 'B':
    Compound: Alpha-1,4-N-acetylhexosaminyltransferase EXTL2
    Species: Mus musculus [TaxId:10090]
    Gene: EXTL2 OR EXTR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1on6b_
  • Heterogens: MN, UD1, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1on6A (A:)
    tnllpnikedkmltlrreikspsksaldsftlimqtynrtdlllrllnhyqavpslhkvi
    vvwnnvgekgpeelwnslgphpipvifkpqtankmrnrlqvfpevetnavlmvdddtlis
    aqdlvfafsiwqqfpdqiigfvprkhvstssgiysyggfelqtpgpgngdqysmvligas
    ffnskylelfqkqpaavhalidetqncddiamnflvtrhtgkpsgifvkpinmvnleket
    ngysgmwhraehflqrsycinklvniydgmplkysnimisqfgfpyanhkskm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1on6A (A:)
    aldsftlimqtynrtdlllrllnhyqavpslhkvivvwnnvgekgpeelwnslgphpipv
    ifkpqtankmrnrlqvfpevetnavlmvdddtlisaqdlvfafsiwqqfpdqiigfvprk
    hvstssgiysyggfelqtpgpgngdqysmvligasffnskylelfqkqpaavhalidetq
    ncddiamnflvtrhtgkpsgifvkpinmvnleraehflqrsycinklvniydgmplkysn
    imisqfgfpyanhk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1on6B (B:)
    tnllpnikedkmltlrreikspsksaldsftlimqtynrtdlllrllnhyqavpslhkvi
    vvwnnvgekgpeelwnslgphpipvifkpqtankmrnrlqvfpevetnavlmvdddtlis
    aqdlvfafsiwqqfpdqiigfvprkhvstssgiysyggfelqtpgpgngdqysmvligas
    ffnskylelfqkqpaavhalidetqncddiamnflvtrhtgkpsgifvkpinmvnleket
    ngysgmwhraehflqrsycinklvniydgmplkysnimisqfgfpyanhkskm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1on6B (B:)
    saldsftlimqtynrtdlllrllnhyqavpslhkvivvwnnvgekgpeelwnslgphpip
    vifkpqtankmrnrlqvfpevetnavlmvdddtlisaqdlvfafsiwqqfpdqiigfvpr
    khvstssgiysyggfelqtpgpgngdqysmvligasffnskylelfqkqpaavhalidet
    qncddiamnflvtrhtgkpsgifvkpinmvnlekeraehflqrsycinklvniydgmplk
    ysnimisqfgfpyanhk