PDB entry 1on4

View 1on4 on RCSB PDB site
Description: solution structure of soluble domain of sco1 from bacillus subtilis
Deposited on 2003-02-27, released 2003-11-11
The last revision prior to the SCOP 1.67 freeze date was dated 2003-11-11, with a file datestamp of 2003-11-11.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1on4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1on4A (A:)
hmleikdplnyevepftfqnqdgknvsleslkgevwladfiftnceticppmtahmtdlq
kklkaenidvriisfsvdpendkpkqlkkfaanyplsfdnwdfltgysqseieefalksf
kaivkkpegedqvihqssfylvgpdgkvlkdyngventpyddiisdvksastlk