PDB entry 1on4

View 1on4 on RCSB PDB site
Description: Solution structure of soluble domain of Sco1 from Bacillus Subtilis
Class: metal binding protein
Keywords: COX assembly protein, copper protein, NMR structure, Sco1 from B. subtilis, thioredoxin-like fold, YPMQ, Structural Proteomics in Europe, SPINE, Structural Genomics, metal binding protein
Deposited on 2003-02-27, released 2003-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sco1
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YPMQ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54178 (4-173)
      • cloning artifact (0-3)
      • see remark 999 (65)
    Domains in SCOPe 2.07: d1on4a1, d1on4a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1on4A (A:)
    hmleikdplnyevepftfqnqdgknvsleslkgevwladfiftnceticppmtahmtdlq
    kklkaenidvriisfsvdpendkpkqlkkfaanyplsfdnwdfltgysqseieefalksf
    kaivkkpegedqvihqssfylvgpdgkvlkdyngventpyddiisdvksastlk