PDB entry 1on1

View 1on1 on RCSB PDB site
Description: Bacillus Subtilis Manganese Transport Regulator (Mntr) Bound To Manganese, AB Conformation.
Class: transcription
Keywords: Helix-turn-helix, DNA-Binding Protein, Metalloregulatory Protein, TRANSCRIPTION
Deposited on 2003-02-26, released 2003-07-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.216
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator mntR
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54512
      • see remark 999 (80)
    Domains in SCOPe 2.08: d1on1a1, d1on1a2
  • Chain 'B':
    Compound: Transcriptional regulator mntR
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54512
      • see remark 999 (80)
    Domains in SCOPe 2.08: d1on1b1, d1on1b2
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1on1A (A:)
    mttpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrgl
    vltskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyf
    eeddarkkdlksiqkktehhnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1on1A (A:)
    ttpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliglvltskg
    kkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfeeddar
    kkdlksiqkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1on1B (B:)
    mttpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrgl
    vltskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyf
    eeddarkkdlksiqkktehhnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1on1B (B:)
    ttpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliglvltskg
    kkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfeeddar
    kkdlksiqkk