PDB entry 1on0

View 1on0 on RCSB PDB site
Description: crystal structure of putative acetyltransferase (yycn) from bacillus subtilis, northeast structural genomics consortium target sr144
Deposited on 2003-02-26, released 2003-03-11
The last revision prior to the SCOP 1.67 freeze date was dated 2003-03-11, with a file datestamp of 2003-03-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.225
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1on0a_
  • Chain 'B':
    Domains in SCOP 1.67: d1on0b_
  • Chain 'C':
    Domains in SCOP 1.67: d1on0c_
  • Chain 'D':
    Domains in SCOP 1.67: d1on0d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1on0A (A:)
    mtimltpmqteefrsyltyttkhyaeekvkagtwlpedaqllskqvftdllprgletphh
    hlwslklnekdivgwlwihaepehpqqeafiydfglyepyrgkgyakqalaaldqaarsm
    girklslhvfahnqtarklyeqtgfqetdvvmskklle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1on0A (A:)
    timltpmqteefrsyltyttkhyaeekvkagtwlpedaqllskqvftdllprgletphhh
    lwslklnekdivgwlwihaepehpqqeafiydfglyepyrgkgyakqalaaldqaarsmg
    irklslhvfahnqtarklyeqtgfqetdvvmskkll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1on0B (B:)
    mtimltpmqteefrsyltyttkhyaeekvkagtwlpedaqllskqvftdllprgletphh
    hlwslklnekdivgwlwihaepehpqqeafiydfglyepyrgkgyakqalaaldqaarsm
    girklslhvfahnqtarklyeqtgfqetdvvmskklle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1on0B (B:)
    timltpmqteefrsyltyttkhyaeekvkagtwlpedaqllskqvftdllprgletphhh
    lwslklnekdivgwlwihaepehpqqeafiydfglyepyrgkgyakqalaaldqaarsmg
    irklslhvfahnqtarklyeqtgfqetdvvmskklle
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1on0C (C:)
    mtimltpmqteefrsyltyttkhyaeekvkagtwlpedaqllskqvftdllprgletphh
    hlwslklnekdivgwlwihaepehpqqeafiydfglyepyrgkgyakqalaaldqaarsm
    girklslhvfahnqtarklyeqtgfqetdvvmskklle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1on0C (C:)
    timltpmqteefrsyltyttkhyaeekvkagtwlpedaqllskqvftdllprgletphhh
    lwslklnekdivgwlwihaepehpqqeafiydfglyepyrgkgyakqalaaldqaarsmg
    irklslhvfahnqtarklyeqtgfqetdvvmskkll
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1on0D (D:)
    mtimltpmqteefrsyltyttkhyaeekvkagtwlpedaqllskqvftdllprgletphh
    hlwslklnekdivgwlwihaepehpqqeafiydfglyepyrgkgyakqalaaldqaarsm
    girklslhvfahnqtarklyeqtgfqetdvvmskklle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1on0D (D:)
    timltpmqteefrsyltyttkhyaeekvkagtwlpedaqllskqvftdllprgletphhh
    lwslklnekdivgwlwihaepehpqqeafiydfglyepyrgkgyakqalaaldqaarsmg
    irklslhvfahnqtarklyeqtgfqetdvvmskklle