PDB entry 1omo

View 1omo on RCSB PDB site
Description: alanine dehydrogenase dimer w/bound NAD (archaeal)
Class: oxidoreductase
Keywords: two-domain, beta-sandwich-dimer, Rossmann-fold NAD domain, human mu crystallin homolog, human thyroid-hormone-binder homolog, OXIDOREDUCTASE
Deposited on 2003-02-25, released 2004-07-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.32 Å
R-factor: 0.203
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alanine dehydrogenase
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1omoa_
  • Chain 'B':
    Compound: alanine dehydrogenase
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1omob_
  • Heterogens: NA, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1omoA (A:)
    metliltqeeveslismdeamnaveeafrlyalgkaqmppkvylefekgdlrampahlmg
    yaglkwvnshpgnpdkglptvmalmilnspetgfplavmdatyttslrtgaaggiaakyl
    arknssvfgfigcgtqayfqlealrrvfdigevkaydvrekaakkfvsycedrgisasvq
    paeeasrcdvlvtttpsrkpvvkaewveegthinaigadgpgkqeldveilkkakivvdd
    leqakhggeinvavskgvigvedvhatigeviaglkdgresdeeitifdstglaiqdvav
    akvvyenalsknvgskikffri
    

    Sequence, based on observed residues (ATOM records): (download)
    >1omoA (A:)
    metliltqeeveslismdeamnaveeafrlyalgkaqmppkvylefekgdlrampahlmg
    yaglkwvnshpgnpdkglptvmalmilnspetgfplavmdatyttslrtgaaggiaakyl
    arknssvfgfigcgtqayfqlealrrvfdigevkaydvrekaakkfvsycedrgisasvq
    paeeasrcdvlvtttpsrkpvvkaewveegthinaigadgpgkqeldveilkkakivvdd
    leqakhggeinvavskgvigvedvhatigeviaglkdgresdeeitifdstglaiqdvav
    akvvyenalsknvgskikff
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1omoB (B:)
    metliltqeeveslismdeamnaveeafrlyalgkaqmppkvylefekgdlrampahlmg
    yaglkwvnshpgnpdkglptvmalmilnspetgfplavmdatyttslrtgaaggiaakyl
    arknssvfgfigcgtqayfqlealrrvfdigevkaydvrekaakkfvsycedrgisasvq
    paeeasrcdvlvtttpsrkpvvkaewveegthinaigadgpgkqeldveilkkakivvdd
    leqakhggeinvavskgvigvedvhatigeviaglkdgresdeeitifdstglaiqdvav
    akvvyenalsknvgskikffri
    

    Sequence, based on observed residues (ATOM records): (download)
    >1omoB (B:)
    metliltqeeveslismdeamnaveeafrlyalgkaqmppkvylefekgdlrampahlmg
    yaglkwvnshpgnpdkglptvmalmilnspetgfplavmdatyttslrtgaaggiaakyl
    arknssvfgfigcgtqayfqlealrrvfdigevkaydvrekaakkfvsycedrgisasvq
    paeeasrcdvlvtttpsrkpvvkaewveegthinaigadgpgkqeldveilkkakivvdd
    leqakhggeinvavskgvigvedvhatigeviaglkdgresdeeitifdstglaiqdvav
    akvvyenalsknvgskikff