PDB entry 1omh

View 1omh on RCSB PDB site
Description: conjugative relaxase trwc in complex with orit dna. metal-free structure.
Deposited on 2003-02-25, released 2003-11-25
The last revision prior to the SCOP 1.69 freeze date was dated 2003-12-09, with a file datestamp of 2003-12-09.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.246
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1omha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1omhA (A:)
    mlshmvltrqdigraasyyedgaddyyakdgdasewqgkgaeelglsgevdskrfrella
    gnigeghrimrsatrqdskerigldltfsapksvslqalvagdaeiikahdravartleq
    aearaqarqkiqgktriettgnlvigkfrhetsrerdpqlhthavilnmtkrsdgqwral
    kndeivkatrylgavynaelahelqklgyqlrygkdgnfdlahidrqqiegfskrteqia
    ewyaargldpnsvsleqkqaakvlsrakktsvdrealraewqatakelgidfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1omhA (A:)
    mlshmvltrqdigraasyygdasewqgkgaeelglsgevdskrfrellagnigeghrimr
    satrqdskerigldltfsapksvslqalvagdaeiikahdravartleqaearaqarqki
    qgktriettgnlvigkfrhetsrerdpqlhthavilnmtkrsdgqwralkndeivkatry
    lgavynaelahelqklgyqlrygkdgnfdlahidrqqiegfskrteqiaewyaargldpn
    svsleqkqaakvlsrakktsvdrealraewqatakelgidfs