PDB entry 1ome

View 1ome on RCSB PDB site
Description: crystal structure of the omega loop deletion mutant (residues 163-178 deleted) of beta-lactamase from staphylococcus aureus pc1
Class: hydrolase
Keywords: hydrolase, beta-lactamase, beta-lactam antibiotic resistance
Deposited on 1998-02-09, released 1998-05-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.19
AEROSPACI score: -1.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: BLAZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1omea_
  • Chain 'B':
    Compound: Beta-lactamase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: BLAZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1omeb_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1omeA (A:)
    mkelndlekkynahigvyaldtksgkevkfnsdkrfayastskainsailleqvpynkln
    kkvhinkddivayspilekyvgkditlkalieasmtysdntannkiikeiggikkvkqrl
    kelgdkvtnpvryeielnyyspkskkdtstpaafgktlnkliangklskenkkflldlml
    nnksgdtlikdgvpkdykvadksgqaityasrndvafvypkgqsepivlviftnkdnksd
    kpndklisetaksvmkef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1omeA (A:)
    kelndlekkynahigvyaldtksgkevkfnsdkrfayastskainsailleqvpynklnk
    kvhinkddivayspilekyvgkditlkalieasmtysdntannkiikeiggikkvkqrlk
    elgdkvtnpdtstpaafgktlnkliangklskenkkflldlmlnnksgdtlikdgvpkdy
    kvadksgqaityasrndvafvypkgqsepivlviftnkdnksdkpndklisetaksvmke
    f
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1omeB (B:)
    mkelndlekkynahigvyaldtksgkevkfnsdkrfayastskainsailleqvpynkln
    kkvhinkddivayspilekyvgkditlkalieasmtysdntannkiikeiggikkvkqrl
    kelgdkvtnpvryeielnyyspkskkdtstpaafgktlnkliangklskenkkflldlml
    nnksgdtlikdgvpkdykvadksgqaityasrndvafvypkgqsepivlviftnkdnksd
    kpndklisetaksvmkef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1omeB (B:)
    elndlekkynahigvyaldtksgkevkfnsdkrfayastskainsailleqvpynklnkk
    vhinkddivayspilekyvgkditlkalieasmtysdntannkiikeiggikkvkqrlke
    lgdkvtnpdtstpaafgktlnkliangklskenkkflldlmlnnksgdtlikdgvpkdyk
    vadksgqaityasrndvafvypkgqsepivlviftnkdnksdkpndklisetaksvmkef