PDB entry 1om9

View 1om9 on RCSB PDB site
Description: Structure of the GGA1-appendage in complex with the p56 binding peptide
Class: protein transport, signaling protein
Keywords: beta sandwich, beta augmentation, GGA, adaptin, clathrin adaptor
Deposited on 2003-02-25, released 2003-07-29
The last revision prior to the SCOP 1.73 freeze date was dated 2003-07-29, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.216
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor binding protein GGA1
    Species: HOMO SAPIENS
    Gene: GGA1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1om9a_
  • Chain 'B':
    Compound: ADP-ribosylation factor binding protein GGA1
    Species: HOMO SAPIENS
    Gene: GGA1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1om9b_
  • Chain 'P':
    Compound: 15-mer peptide fragment of p56
    Species: synthetic, synthetic
  • Chain 'Q':
    Compound: 15-mer peptide fragment of p56
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1om9A (A:)
    mhhhhhhmelslasitvplesikpsnilpvtvydqhgfrilfhfardplpgrsdvlvvvv
    smlstapqpirnivfqsavpkvmkvklqppsgtelpafnpivhpsaitqvlllanpqkek
    vrlrykltftmgdqtynemgdvdqfpppetwgsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1om9A (A:)
    asitvplesikpsnilpvtvydqhgfrilfhfardplpgrsdvlvvvvsmlstapqpirn
    ivfqsavpkvmkvklqppsgtelpafnpivhpsaitqvlllanpqkekvrlrykltftmg
    dqtynemgdvdqfpppetwgsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1om9B (B:)
    mhhhhhhmelslasitvplesikpsnilpvtvydqhgfrilfhfardplpgrsdvlvvvv
    smlstapqpirnivfqsavpkvmkvklqppsgtelpafnpivhpsaitqvlllanpqkek
    vrlrykltftmgdqtynemgdvdqfpppetwgsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1om9B (B:)
    asitvplesikpsnilpvtvydqhgfrilfhfardplpgrsdvlvvvvsmlstapqpirn
    ivfqsavpkvmkvklqppsgtelpafnpivhpsaitqvlllanpqkekvrlrykltftmg
    dqtynemgdvdqfpppetwgsl
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.