PDB entry 1om3

View 1om3 on RCSB PDB site
Description: fab 2g12 unliganded
Deposited on 2003-02-24, released 2003-07-15
Made obsolete by 6n32 on 2018-11-28

The last revision prior to the SCOP 1.69 freeze date was dated 2003-07-15, with a file datestamp of 2003-07-15.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.227
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1om3H (H:)
    evqlvesggglvkaggslilscgvsnfrisahtmnwvrrvpggglewvasistsstyrdy
    adavkgrftvsrddledfvylqmhkmrvedtaiyycarkgsdrlsdndpfdawgpgtvvt
    vspastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1om3H (H:)
    evqlvesggglvkaggslilscgvsnfrisahtmnwvrrvpggglewvasistsstyrdy
    adavkgrftvsrddledfvylqmhkmrvedtaiyycarkgsdrlsdndpfdawgpgtvvt
    vspastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1om3K (K:)
    evqlvesggglvkaggslilscgvsnfrisahtmnwvrrvpggglewvasistsstyrdy
    adavkgrftvsrddledfvylqmhkmrvedtaiyycarkgsdrlsdndpfdawgpgtvvt
    vspastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1om3L (L:)
    vvmtqspstlsasvgdtititcrasqsietwlawyqqkpgkapklliykastlktgvpsr
    fsgsgsgteftltisglqfddfatyhcqhyagysatfgqgtrveikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1om3M (M:)
    vvmtqspstlsasvgdtititcrasqsietwlawyqqkpgkapklliykastlktgvpsr
    fsgsgsgteftltisglqfddfatyhcqhyagysatfgqgtrveikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrge