PDB entry 1om2

View 1om2 on RCSB PDB site
Description: solution nmr structure of the mitochondrial protein import receptor tom20 from rat in a complex with a presequence peptide derived from rat aldehyde dehydrogenase (aldh)
Class: receptor/oxidoreductase complex
Keywords: mitochondrial protein import across outer membrane, receptor for presequences, mitochondrial targeting signal, presequence peptide, receptor/oxidoreductase complex complex
Deposited on 1999-04-23, released 2000-02-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (mitochondrial import receptor subunit tom20)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q62760 (0-94)
      • variant (89)
    Domains in SCOPe 2.08: d1om2a_
  • Chain 'B':
    Compound: protein (mitochondrial aldehyde dehydrogenase)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11884 (0-10)
      • engineered mutation (9)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1om2A (A:)
raglsklpdlkdaeavqkffleeiqlgeellaqgdyekgvdhltnaiavcgqpqqllqvl
qqtlpppvfqmlltklptisqrivsaqslgeddve

  • Chain 'B':
    No sequence available.