PDB entry 1om0

View 1om0 on RCSB PDB site
Description: crystal structure of xylanase inhibitor protein (XIP-I) from wheat
Class: sugar binding protein
Keywords: beta-alpha barrel, sugar binding protein
Deposited on 2003-02-24, released 2003-06-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.197
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Xylanase Inhibitor Protein I
    Species: Triticum aestivum [TaxId:4565]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8L5C6 (0-273)
      • see remark 999 (36)
      • see remark 999 (183)
    Domains in SCOPe 2.04: d1om0a_
  • Heterogens: NDG, NAG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1om0A (A:)
    aggktgqvtvfwgrnkaegslreacdsgmytmvtmsfldvfgangkyhldlsghdlssvg
    adikhcqskgvpvslsiggygtgyslpsnrsaldlfdhlwnsyfggskpsvprpfgdawl
    dgvdlflehgtpadrydvlalelakhnirggpgkplhltatvrcgyppaahvgralatgi
    fervhvrtyesdkwcnqnlgwegswdkwtaaypatrfyvgltaddkshqwvhpknvyygv
    apvaqkkdnyggimlwdryfdkqtnysslikyya