PDB entry 1olz

View 1olz on RCSB PDB site
Description: the ligand-binding face of the semaphorins revealed by the high resolution crystal structure of sema4d
Class: developmental protein
Keywords: developmental protein, cd100, semaphorin, beta-propeller, psi domain, ig-like domain, extracellular receptor, neurogenesis, glycoprotein developmental protein, structural proteomics in europe, spine, structural genomics
Deposited on 2003-08-19, released 2003-09-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.206
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: semaphorin 4d
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1olza1, d1olza2, d1olza3
  • Chain 'B':
    Compound: semaphorin 4d
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1olzb1, d1olzb2, d1olzb3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1olzA (A:)
    mafapipritwehrevhlvqfhepdiynysalllsedkdtlyigareavfavnalnisek
    qhevywkvsedkkakcaekgkskqteclnyirvlqplsatslyvcgtnafqpacdhlnlt
    sfkflgknedgkgrcpfdpahsytsvmvdgelysgtsynflgsepiisrnsshsplrtey
    aipwlnepsfvfadvirkspdspdgeddrvyffftevsveyefvfrvlipriarvckgdq
    gglrtlqkkwtsflkarlicsrpdsglvfnvlrdvfvlrspglkvpvfyalftpqlnnvg
    lsavcaynlstaeevfshgkymqsttveqshtkwvryngpvpkprpgacidsearaanyt
    sslnlpdktlqfvkdhplmddsvtpidnrprlikkdvnytqivvdrtqaldgtvydvmfv
    stdrgalhkaislehavhiieetqlfqdfepvqtlllsskkgnrfvyagsnsgvvqapla
    fcgkhgtcedcvlardpycawspptatcvalhqtespsrgliqemsgdasvcpdkskgsy
    rqhffkhggtaelkcsqksnlarvfwkfqngvlkaespkyglmgrknllifnlsegdsgv
    yqclseervknktvfqvvakhvlevkvvpkpvvaptlsvvqtegsriatkvlvastkhhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1olzA (A:)
    fapipritwehrevhlvqfhepdiynysalllsedkdtlyigareavfavnalnisekqh
    evywkvsedkkakcaekgkskqteclnyirvlqplsatslyvcgtnafqpacdhlnltsf
    kflgknedgkgrcpfdpahsytsvmvdgelysgtsynflgsepiisrnsshsplrteyai
    pwlnepsfvfadvirkspgeddrvyffftevsveyefvfrvlipriarvckgdqgglrtl
    qkkwtsflkarlicsrpdsglvfnvlrdvfvlrspglkvpvfyalftpqlnnvglsavca
    ynlstaeevfshgkymqsttveqshtkwvryngpvpkprpgacidsearaanytsslnlp
    dktlqfvkdhplmddsvtpidnrprlikkdvnytqivvdrtqaldgtvydvmfvstdrga
    lhkaislehavhiieetqlfqdfepvqtlllsskkgnrfvyagsnsgvvqaplafcgkhg
    tcedcvlardpycawspptatcvalhqtespsrgliqemsgdasvcpdkskgsyrqhffk
    hggtaelkcsqksnlarvfwkfqngvlkaespkyglmgrknllifnlsegdsgvyqclse
    ervknktvfqvvakhvlevkvv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1olzB (B:)
    mafapipritwehrevhlvqfhepdiynysalllsedkdtlyigareavfavnalnisek
    qhevywkvsedkkakcaekgkskqteclnyirvlqplsatslyvcgtnafqpacdhlnlt
    sfkflgknedgkgrcpfdpahsytsvmvdgelysgtsynflgsepiisrnsshsplrtey
    aipwlnepsfvfadvirkspdspdgeddrvyffftevsveyefvfrvlipriarvckgdq
    gglrtlqkkwtsflkarlicsrpdsglvfnvlrdvfvlrspglkvpvfyalftpqlnnvg
    lsavcaynlstaeevfshgkymqsttveqshtkwvryngpvpkprpgacidsearaanyt
    sslnlpdktlqfvkdhplmddsvtpidnrprlikkdvnytqivvdrtqaldgtvydvmfv
    stdrgalhkaislehavhiieetqlfqdfepvqtlllsskkgnrfvyagsnsgvvqapla
    fcgkhgtcedcvlardpycawspptatcvalhqtespsrgliqemsgdasvcpdkskgsy
    rqhffkhggtaelkcsqksnlarvfwkfqngvlkaespkyglmgrknllifnlsegdsgv
    yqclseervknktvfqvvakhvlevkvvpkpvvaptlsvvqtegsriatkvlvastkhhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1olzB (B:)
    fapipritwehrevhlvqfhepdiynysalllsedkdtlyigareavfavnalnisekqh
    evywkvsedkkakcaekgkskqteclnyirvlqplsatslyvcgtnafqpacdhlnltsf
    kflgknedgkgrcpfdpahsytsvmvdgelysgtsynflgsepiisrnsshsplrteyai
    pwlnepsfvfadvirkspgeddrvyffftevsveyefvfrvlipriarvckgdqgglrtl
    qkkwtsflkarlicsrpdsglvfnvlrdvfvlrspglkvpvfyalftpqlnnvglsavca
    ynlstaeevfshgkymqsttveqshtkwvryngpvpkprpgacidsearaanytsslnlp
    dktlqfvkdhplmddsvtpidnrprlikkdvnytqivvdrtqaldgtvydvmfvstdrga
    lhkaislehavhiieetqlfqdfepvqtlllsskkgnrfvyagsnsgvvqaplafcgkhg
    tcedcvlardpycawspptatcvalhqtespsrgliqemsgdasvcpdkskgsyrqhffk
    hggtaelkcsqksnlarvfwkfqngvlkaespkyglmgrknllifnlsegdsgvyqclse
    ervknktvfqvvakhvlevkvv