PDB entry 1olz

View 1olz on RCSB PDB site
Description: the ligand-binding face of the semaphorins revealed by the high resolution crystal structure of sema4d
Deposited on 2003-08-19, released 2003-09-11
The last revision prior to the SCOP 1.67 freeze date was dated 2003-09-11, with a file datestamp of 2003-09-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.206
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1olzA (A:)
    mafapipritwehrevhlvqfhepdiynysalllsedkdtlyigareavfavnalnisek
    qhevywkvsedkkakcaekgkskqteclnyirvlqplsatslyvcgtnafqpacdhlnlt
    sfkflgknedgkgrcpfdpahsytsvmvdgelysgtsynflgsepiisrnsshsplrtey
    aipwlnepsfvfadvirkspdspdgeddrvyffftevsveyefvfrvlipriarvckgdq
    gglrtlqkkwtsflkarlicsrpdsglvfnvlrdvfvlrspglkvpvfyalftpqlnnvg
    lsavcaynlstaeevfshgkymqsttveqshtkwvryngpvpkprpgacidsearaanyt
    sslnlpdktlqfvkdhplmddsvtpidnrprlikkdvnytqivvdrtqaldgtvydvmfv
    stdrgalhkaislehavhiieetqlfqdfepvqtlllsskkgnrfvyagsnsgvvqapla
    fcgkhgtcedcvlardpycawspptatcvalhqtespsrgliqemsgdasvcpdkskgsy
    rqhffkhggtaelkcsqksnlarvfwkfqngvlkaespkyglmgrknllifnlsegdsgv
    yqclseervknktvfqvvakhvlevkvvpkpvvaptlsvvqtegsriatkvlvastkhhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1olzA (A:)
    fapipritwehrevhlvqfhepdiynysalllsedkdtlyigareavfavnalnisekqh
    evywkvsedkkakcaekgkskqteclnyirvlqplsatslyvcgtnafqpacdhlnltsf
    kflgknedgkgrcpfdpahsytsvmvdgelysgtsynflgsepiisrnsshsplrteyai
    pwlnepsfvfadvirkspgeddrvyffftevsveyefvfrvlipriarvckgdqgglrtl
    qkkwtsflkarlicsrpdsglvfnvlrdvfvlrspglkvpvfyalftpqlnnvglsavca
    ynlstaeevfshgkymqsttveqshtkwvryngpvpkprpgacidsearaanytsslnlp
    dktlqfvkdhplmddsvtpidnrprlikkdvnytqivvdrtqaldgtvydvmfvstdrga
    lhkaislehavhiieetqlfqdfepvqtlllsskkgnrfvyagsnsgvvqaplafcgkhg
    tcedcvlardpycawspptatcvalhqtespsrgliqemsgdasvcpdkskgsyrqhffk
    hggtaelkcsqksnlarvfwkfqngvlkaespkyglmgrknllifnlsegdsgvyqclse
    ervknktvfqvvakhvlevkvv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1olzB (B:)
    mafapipritwehrevhlvqfhepdiynysalllsedkdtlyigareavfavnalnisek
    qhevywkvsedkkakcaekgkskqteclnyirvlqplsatslyvcgtnafqpacdhlnlt
    sfkflgknedgkgrcpfdpahsytsvmvdgelysgtsynflgsepiisrnsshsplrtey
    aipwlnepsfvfadvirkspdspdgeddrvyffftevsveyefvfrvlipriarvckgdq
    gglrtlqkkwtsflkarlicsrpdsglvfnvlrdvfvlrspglkvpvfyalftpqlnnvg
    lsavcaynlstaeevfshgkymqsttveqshtkwvryngpvpkprpgacidsearaanyt
    sslnlpdktlqfvkdhplmddsvtpidnrprlikkdvnytqivvdrtqaldgtvydvmfv
    stdrgalhkaislehavhiieetqlfqdfepvqtlllsskkgnrfvyagsnsgvvqapla
    fcgkhgtcedcvlardpycawspptatcvalhqtespsrgliqemsgdasvcpdkskgsy
    rqhffkhggtaelkcsqksnlarvfwkfqngvlkaespkyglmgrknllifnlsegdsgv
    yqclseervknktvfqvvakhvlevkvvpkpvvaptlsvvqtegsriatkvlvastkhhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1olzB (B:)
    fapipritwehrevhlvqfhepdiynysalllsedkdtlyigareavfavnalnisekqh
    evywkvsedkkakcaekgkskqteclnyirvlqplsatslyvcgtnafqpacdhlnltsf
    kflgknedgkgrcpfdpahsytsvmvdgelysgtsynflgsepiisrnsshsplrteyai
    pwlnepsfvfadvirkspgeddrvyffftevsveyefvfrvlipriarvckgdqgglrtl
    qkkwtsflkarlicsrpdsglvfnvlrdvfvlrspglkvpvfyalftpqlnnvglsavca
    ynlstaeevfshgkymqsttveqshtkwvryngpvpkprpgacidsearaanytsslnlp
    dktlqfvkdhplmddsvtpidnrprlikkdvnytqivvdrtqaldgtvydvmfvstdrga
    lhkaislehavhiieetqlfqdfepvqtlllsskkgnrfvyagsnsgvvqaplafcgkhg
    tcedcvlardpycawspptatcvalhqtespsrgliqemsgdasvcpdkskgsyrqhffk
    hggtaelkcsqksnlarvfwkfqngvlkaespkyglmgrknllifnlsegdsgvyqclse
    ervknktvfqvvakhvlevkvv