PDB entry 1olx

View 1olx on RCSB PDB site
Description: roles of his291-alpha and his146-beta' in the reductive acylation reaction catalyzed by human branched-chain alpha-ketoacid dehydrogenase
Class: oxidoreductase
Keywords: oxidoreductase, ketoacid dehydrogenase, branched-chain, multi-enzyme complex, acylation, oxidative decarboxylation oxidoreductase, maple syrup urine disease, thiamine phosphate
Deposited on 2003-08-18, released 2003-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.161
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-oxoisovalerate dehydrogenase alpha subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1olxa_
  • Chain 'B':
    Compound: 2-oxoisovalerate dehydrogenase beta subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21953 (Start-341)
      • engineered mutation (145)
    Domains in SCOPe 2.07: d1olxb1, d1olxb2
  • Heterogens: K, MN, TDP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1olxA (A:)
    sslddkpqfpgasaefidklefiqpnvisgipiyrvmdrqgqiinpsedphlpkekvlkl
    yksmtllntmdrilyesqrqgrisfymtnygeegthvgsaaaldntdlvfgqyreagvlm
    yrdyplelfmaqcygnisdlgkgrqmpvhygckerhfvtissplatqipqavgaayaakr
    ananrvvicyfgegaasegdahagfnfaatlecpiiffcrnngyaistptseqyrgdgia
    argpgygimsirvdgndvfavynatkearrravaenqpflieamtyrighhstsddssay
    rsvdevnywdkqdhpisrlrhyllsqgwwdeeqekawrkqsrrkvmeafeqaerkpkpnp
    nllfsdvyqempaqlrkqqeslarhlqtygehypldhfdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1olxA (A:)
    dkpqfpgasaefidklefiqpnvisgipiyrvmdrqgqiinpsedphlpkekvlklyksm
    tllntmdrilyesqrqgrisfymtnygeegthvgsaaaldntdlvfgqyreagvlmyrdy
    plelfmaqcygnisdlgkgrqmpvhygckerhfvtissplatqipqavgaayaakranan
    rvvicyfgegaasegdahagfnfaatlecpiiffcrnngyaistptseqyrgdgiaargp
    gygimsirvdgndvfavynatkearrravaenqpflieamtyrighhstsddssayrnyw
    dkqdhpisrlrhyllsqgwwdeeqekawrkqsrrkvmeafeqaerkpkpnpnllfsdvyq
    empaqlrkqqeslarhlqtygehypldhfdk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1olxB (B:)
    vahftfqpdpepreygqtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvgl
    rdkygkdrvfntplceqgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryr
    sgdlfncgsltirspwgcvghgalyasqspeaffahcpgikvviprspfqakglllscie
    dknpciffepkilyraaaeevpiepyniplsqaeviqegsdvtlvawgtqvhvirevasm
    akeklgvscevidlrtiipwdvdticksviktgrllisheapltggfaseisstvqeecf
    lnleapisrvcgydtpfphifepfyipdkwkcydalrkminy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1olxB (B:)
    ahftfqeygqtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvglrdkygkd
    rvfntplceqgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryrsgdlfnc
    gsltirspwgcvghgalyasqspeaffahcpgikvviprspfqakglllsciedknpcif
    fepkilyraaaeevpiepyniplsqaeviqegsdvtlvawgtqvhvirevasmakeklgv
    scevidlrtiipwdvdticksviktgrllisheapltggfaseisstvqeecflnleapi
    srvcgydtpfphifepfyipdkwkcydalrkminy