PDB entry 1olr

View 1olr on RCSB PDB site
Description: The Humicola grisea Cel12A Enzyme Structure at 1.2 A Resolution
Class: hydrolase
Keywords: hydrolase, cellulase, cellulose degradation, endoglucanase, glycosyl hydrolase, gh family 12, humicola grisea cel12a
Deposited on 2003-08-11, released 2003-11-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-03-11, with a file datestamp of 2020-03-06.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-beta-1,4-glucanase
    Species: HUMICOLA GRISEA [TaxId:5527]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1olra_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1olrA (A:)
    eirslcelygywsgngyellnnlwgkdtatsgwqctyldgtnnggiqwstawewqgapdn
    vksypyvgkqiqrgrkisdinsmrtsvswtydrtdiranvaydvftardpdhpnwggdye
    lmiwlaryggiypigtfhsqvnlagrtwdlwtgyngnmrvysflppsgdirdfscdikdf
    fnylernhgypareqnlivyqvgtecftggparftcrdfradlw