PDB entry 1olq

View 1olq on RCSB PDB site
Description: The Trichoderma reesei cel12a p210c mutant, structure at 1.7 a resolution.
Class: hydrolase
Keywords: hydrolase, cellulase, cellulose degradation, endoglucanase, glycosyl hydrolase, gh family 12
Deposited on 2003-08-11, released 2003-11-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.21035
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-beta-1,4-glucanase
    Species: TRICHODERMA REESEI [TaxId:51453]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00095 (0-217)
      • engineered mutation (200)
    Domains in SCOPe 2.06: d1olqa_
  • Chain 'B':
    Compound: endo-beta-1,4-glucanase
    Species: TRICHODERMA REESEI [TaxId:51453]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00095 (0-217)
      • engineered mutation (200)
    Domains in SCOPe 2.06: d1olqb_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1olqA (A:)
    etscdqwatftgngytvsnnlwgasagsgfgcvtavslsggaswhadwqwsggqnnvksy
    qnsqiaipqkrtvnsissmpttaswsysgsniranvaydlftaanpnhvtysgdyelmiw
    lgkygdigpigssqgtvnvggqswtlyygyngamqvysfvaqtnttnysgdvknffnylr
    dnkgynaagqyvlsyqfgtecftgsgtlnvaswtasin
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1olqB (B:)
    etscdqwatftgngytvsnnlwgasagsgfgcvtavslsggaswhadwqwsggqnnvksy
    qnsqiaipqkrtvnsissmpttaswsysgsniranvaydlftaanpnhvtysgdyelmiw
    lgkygdigpigssqgtvnvggqswtlyygyngamqvysfvaqtnttnysgdvknffnylr
    dnkgynaagqyvlsyqfgtecftgsgtlnvaswtasin