PDB entry 1olh

View 1olh on RCSB PDB site
Description: high-resolution solution structure of the oligomerization domain of p53 by multi-dimensional nmr
Class: anti-oncogene protein
Keywords: anti-oncogene protein
Deposited on 1994-06-13, released 1995-03-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: tumor suppressor p53 (oligomerization domain)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04637 (0-41)
  Domains in SCOPe 2.05: d1olha_
• Chain 'B':
  Compound: tumor suppressor p53 (oligomerization domain)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04637 (0-41)
  Domains in SCOPe 2.05: d1olhb_
• Chain 'C':
  Compound: tumor suppressor p53 (oligomerization domain)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04637 (0-41)
  Domains in SCOPe 2.05: d1olhc_
• Chain 'D':
  Compound: tumor suppressor p53 (oligomerization domain)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04637 (0-41)
  Domains in SCOPe 2.05: d1olhd_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1olhA (A:)
  kkkpldgeyftlqirgrerfemfrelnealelkdaqagkepg
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1olhB (B:)
  kkkpldgeyftlqirgrerfemfrelnealelkdaqagkepg
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1olhC (C:)
  kkkpldgeyftlqirgrerfemfrelnealelkdaqagkepg
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1olhD (D:)
  kkkpldgeyftlqirgrerfemfrelnealelkdaqagkepg