PDB entry 1ol0

View 1ol0 on RCSB PDB site
Description: crystal structure of a camelised human vh
Class: immunoglobulin
Keywords: immunoglobulin, camelised variable heavy domain
Deposited on 2003-08-02, released 2004-01-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.15576
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin g
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OL0 (0-120)
    Domains in SCOPe 2.04: d1ol0a_
  • Chain 'B':
    Compound: immunoglobulin g
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OL0 (0-120)
    Domains in SCOPe 2.04: d1ol0b_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ol0A (A:)
    qvqlvesggglvqpggslrlscaasgftfssyamswfrqapgkereivsavsgsggstyy
    adsvrgrftisrdnskntlylqmnslraedtavyycarepriprppsfdywgqgtlvtvs
    s
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ol0B (B:)
    qvqlvesggglvqpggslrlscaasgftfssyamswfrqapgkereivsavsgsggstyy
    adsvrgrftisrdnskntlylqmnslraedtavyycarepriprppsfdywgqgtlvtvs
    s