PDB entry 1ol0

View 1ol0 on RCSB PDB site
Description: crystal structure of a camelised human vh
Class: immunoglobulin
Keywords: immunoglobulin, camelised variable heavy domain
Deposited on 2003-08-02, released 2004-01-22
The last revision prior to the SCOP 1.75 freeze date was dated 2004-01-22, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.156
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin g
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • PDB 1OL0 (0-120)
    Domains in SCOP 1.75: d1ol0a_
  • Chain 'B':
    Compound: immunoglobulin g
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • PDB 1OL0 (0-120)
    Domains in SCOP 1.75: d1ol0b_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ol0A (A:)
qvqlvesggglvqpggslrlscaasgftfssyamswfrqapgkereivsavsgsggstyy
adsvrgrftisrdnskntlylqmnslraedtavyycarepriprppsfdywgqgtlvtvs
s

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ol0B (B:)
qvqlvesggglvqpggslrlscaasgftfssyamswfrqapgkereivsavsgsggstyy
adsvrgrftisrdnskntlylqmnslraedtavyycarepriprppsfdywgqgtlvtvs
s